IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants. Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants. J. Biol. Chem. (0021-9258) 2008 imex curation Shibata H., Suzuki H., Kakiuchi T., Inuzuka T., Yoshida H., Mizuno T., Maki M. Apoptosis - Interactions involving proteins with a function related to apoptosis mmaki@agr.nagoya-u.ac.jp 10-Jul-2009: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Shibata H., Suzuki H., Kakiuchi T., Inuzuka T., Yoshida H., Mizuno T., Maki M. Apoptosis - Interactions involving proteins with a function related to apoptosis mmaki@agr.nagoya-u.ac.jp Accepted 2009-JUN-27 by JYOTI. 10-Jul-2009: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2008 jyoti Only protein-protein interactions imex curation Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants. Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants. J. Biol. Chem. (0021-9258) 2008 imex curation Shibata H., Suzuki H., Kakiuchi T., Inuzuka T., Yoshida H., Mizuno T., Maki M. Apoptosis - Interactions involving proteins with a function related to apoptosis mmaki@agr.nagoya-u.ac.jp 10-Jul-2009: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Shibata H., Suzuki H., Kakiuchi T., Inuzuka T., Yoshida H., Mizuno T., Maki M. Apoptosis - Interactions involving proteins with a function related to apoptosis mmaki@agr.nagoya-u.ac.jp Accepted 2009-JUN-27 by JYOTI. 10-Jul-2009: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2008 jyoti Only protein-protein interactions imex curation Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants. Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants. J. Biol. Chem. (0021-9258) 2008 imex curation Shibata H., Suzuki H., Kakiuchi T., Inuzuka T., Yoshida H., Mizuno T., Maki M. Apoptosis - Interactions involving proteins with a function related to apoptosis mmaki@agr.nagoya-u.ac.jp 10-Jul-2009: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Shibata H., Suzuki H., Kakiuchi T., Inuzuka T., Yoshida H., Mizuno T., Maki M. Apoptosis - Interactions involving proteins with a function related to apoptosis Western blot signals were detected by the chemiluminescence. mmaki@agr.nagoya-u.ac.jp Accepted 2009-JUN-27 by JYOTI. 10-Jul-2009: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2008 jyoti Only protein-protein interactions imex curation Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants. Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants. J. Biol. Chem. (0021-9258) 2008 imex curation Shibata H., Suzuki H., Kakiuchi T., Inuzuka T., Yoshida H., Mizuno T., Maki M. Apoptosis - Interactions involving proteins with a function related to apoptosis mmaki@agr.nagoya-u.ac.jp 10-Jul-2009: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa predetermined predetermined participant predetermined Shibata H., Suzuki H., Kakiuchi T., Inuzuka T., Yoshida H., Mizuno T., Maki M. Apoptosis - Interactions involving proteins with a function related to apoptosis Binding to biotinylated ALG-2 was measured by reactivity of streptavidin-peroxidase. mmaki@agr.nagoya-u.ac.jp Accepted 2009-JUN-27 by JYOTI. 10-Jul-2009: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2008 jyoti Only protein-protein interactions imex curation Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants. Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants. J. Biol. Chem. (0021-9258) 2008 imex curation Shibata H., Suzuki H., Kakiuchi T., Inuzuka T., Yoshida H., Mizuno T., Maki M. Apoptosis - Interactions involving proteins with a function related to apoptosis mmaki@agr.nagoya-u.ac.jp 10-Jul-2009: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Shibata H., Suzuki H., Kakiuchi T., Inuzuka T., Yoshida H., Mizuno T., Maki M. Apoptosis - Interactions involving proteins with a function related to apoptosis mmaki@agr.nagoya-u.ac.jp Accepted 2009-JUN-27 by JYOTI. 10-Jul-2009: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2008 jyoti Only protein-protein interactions imex curation Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants. Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants. J. Biol. Chem. (0021-9258) 2008 imex curation Shibata H., Suzuki H., Kakiuchi T., Inuzuka T., Yoshida H., Mizuno T., Maki M. Apoptosis - Interactions involving proteins with a function related to apoptosis mmaki@agr.nagoya-u.ac.jp 10-Jul-2009: Contacted by JYOTI. jyoti Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shibata H., Suzuki H., Kakiuchi T., Inuzuka T., Yoshida H., Mizuno T., Maki M. Apoptosis - Interactions involving proteins with a function related to apoptosis mmaki@agr.nagoya-u.ac.jp Accepted 2009-JUN-27 by JYOTI. J. Biol. Chem. (0021-9258) 2008 jyoti Only protein-protein interactions imex curation Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants. Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants. J. Biol. Chem. (0021-9258) 2008 imex curation Shibata H., Suzuki H., Kakiuchi T., Inuzuka T., Yoshida H., Mizuno T., Maki M. Apoptosis - Interactions involving proteins with a function related to apoptosis mmaki@agr.nagoya-u.ac.jp 10-Jul-2009: Contacted by JYOTI. jyoti Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Shibata H., Suzuki H., Kakiuchi T., Inuzuka T., Yoshida H., Mizuno T., Maki M. Apoptosis - Interactions involving proteins with a function related to apoptosis mmaki@agr.nagoya-u.ac.jp Accepted 2009-JUN-27 by JYOTI. 10-Jul-2009: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2008 jyoti Only protein-protein interactions imex curation Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants. Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants. J. Biol. Chem. (0021-9258) 2008 imex curation Shibata H., Suzuki H., Kakiuchi T., Inuzuka T., Yoshida H., Mizuno T., Maki M. Apoptosis - Interactions involving proteins with a function related to apoptosis mmaki@agr.nagoya-u.ac.jp 10-Jul-2009: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Shibata H., Suzuki H., Kakiuchi T., Inuzuka T., Yoshida H., Mizuno T., Maki M. Apoptosis - Interactions involving proteins with a function related to apoptosis mmaki@agr.nagoya-u.ac.jp Accepted 2009-JUN-27 by JYOTI. 10-Jul-2009: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2008 jyoti Only protein-protein interactions imex curation pdc6i_human Programmed cell death 6-interacting protein PDCD6IP AIP1 KIAA1375 ALIX ALG-2-interacting protein 1 Hp95 ALG-2-interacting protein X protein protein human Homo sapiens Human MATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKMVPVSVQQSLAAYNQRKADLVNRSIAQMREATTLANGVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQGGIQTVDQLIKELPELLQRNREILDESLRLLDEEEATDNDLRAKFKERWQRTPSNELYKPLRAEGTNFRTVLDKAVQADGQVKECYQSHRDTIVLLCKPEPELNAAIPSANPAKTMQGSEVVNVLKSLLSNLDEVKKEREGLENDLKSVNFDMTSKFLTALAQDGVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLREEVLKNLATAYDNFVELVANLKEGTKFYNELTEILVRFQNKCSDIVFARKTERDELLKDLQQSIAREPSAPSIPTPAYQSSPAGGHAPTPPTPAPRTMPPTKPQPPARPPPPVLPANRAPSATAPSPVGAGTAAPAPSQTPGSAPPPQAQGPPYPTYPGYPGYCQMPMPMGYNPYAYGQYNMPYPPVYHQSPGQAPYPGPQQPSYPFPQPPQQSYYPQQ DIP protein Q8WUM4 original sequence version: 46 DIP protein Q8WUM4 original sequence version: 67 DIP protein Q8WUM4 original sequence version: 60 DIP protein Q8WUM4 original sequence version: 64 DIP protein Q8WUM4 original sequence version: 66 DIP protein Q8WUM4 original sequence version: 89 DIP protein Q8WUM4 original sequence version: 100 DIP protein Q8WUM4-1 original sequence version: 145 DIP protein Q8WUM4-1 original sequence version: 137 DIP protein Q8WUM4-1 original sequence version: 138 DIP protein Q8WUM4 original sequence version: 138 DIP protein Q8WUM4 original sequence version: 106 573588D1F612EC93 pdcd6_human Programmed cell death protein 6 PDCD6 ALG2 Apoptosis-linked gene 2 protein homolog protein protein human Homo sapiens Human MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV DIP protein O75340 original sequence version: 73 DIP protein O75340 original sequence version: 154 D0B5944CF3C696AD ts101_human Tumor susceptibility gene 101 protein TSG101 ESCRT-I complex subunit TSG101 protein protein human Homo sapiens Human MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY ADD6912FC22DF162 anxa7_human Annexin A7 ANXA7 ANX7 SNX Annexin-7 Annexin VII Synexin OK/SW-cl.95 protein protein human Homo sapiens Human MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAPGGYPAPGGYPGAPQPGGAPSYPGVPPGQGFGVPPGGAGFSGYPQPPSQSYGGGPAQVPLPGGFPGGQMPSQYPGGQPTYPSQINTDSFSSYPVFSPVSLDYSSEPATVTQVTQGTIRPAANFDAIRDAEILRKAMKGFGTDEQAIVDVVANRSNDQRQKIKAAFKTSYGKDLIKDLKSELSGNMEELILALFMPPTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIVGQ BFC688479D8CC2A0 anx11_human Annexin A11 Annexin-11 Annexin XI Calcyclin-associated annexin 50 56 kDa autoantigen ANXA11 ANX11 protein protein human Homo sapiens Human MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND 4ADCAC8F270BFEE4 sc31a_human Protein transport protein Sec31A SEC31A KIAA0905 SEC31L1 HSPC275 HSPC334 SEC31-related protein A SEC31-like protein 1 ABP125 ABP130 Web1-like protein protein protein human Homo sapiens Human MKLKEVDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNASLEIFELDLSDPSLDMKSCATFSSSHRYHKLIWGPYKMDSKGDVSGVLIAGGENGNIILYDPSKIIAGDKEVVIAQNDKHTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPMTPGAKTQPPEDISCIAWNRQVQHILASASPSGRATVWDLRKNEPIIKVSDHSNRMHCSGLAWHPDVATQMVLASEDDRLPVIQMWDLRFASSPLRVLENHARGILAIAWSMADPELLLSCGKDAKILCSNPNTGEVLYELPTNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSTDGLRQKQVDKLSSSFGNLDPFGTGQPLPPLQIPQQTAQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFENVRMPSHQGAEQQQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKIDASQTEFEKNVWSFLKVNFEDDSRGKYLELLGYRKEDLGKKIALALNKVDGANVALKDSDQVAQSDGEESPAAEEQLLGEHIKEEKEESEFLPSSGGTFNISVSGDIDGLITQALLTGNFESAVDLCLHDNRMADAIILAIAGGQELLARTQKKYFAKSQSKITRLITAVVMKNWKEIVESCDLKNWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPPPGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQPYQPAQPYPFGTGGSAMYRPQQPVAPPTSNAYPNTPYISSASSYTGQSQLYAAQHQASSPTSSPATSFPPPPSSGASFQHGGPGAPPSSSAYALPPGTTGTLPAASELPASQRTGPQNGWNDPPALNRVPKKKKMPENFMPPVPITSPIMNPLGDPQSQMLQQQPSAPVPLSSQSSFPQPHLPGGQPFHGVQQPLGQTGMPPSFSKPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILKTTFEDLIQRCLSSATDPQTKRKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHTHIVSTSNFSETSAFMPVLKVVLTQANKLGV 2A633B4436DB7482 pls4_human Phospholipid scramblase 4 Ca(2+)-dependent phospholipid scramblase 4 TRA1 Cell growth-inhibiting gene 43 protein PLSCR4 GIG43 protein protein human Homo sapiens Human MSGVVPTAPEQPAGEMENQTKPPDPRPDAPPEYNSHFLPGPPGTAVPPPTGYPGGLPMGYYSPQQPSTFPLYQPVGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCFETNNRYDIKNNSDQMVYIVTEDTDDFTRNAYRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCFCCPSARQELEVQCPPGVTIGFVAEHWNLCRAVYSIQNEKKENVMRVRGPCSTYGCGSDSVFEVKSLDGISNIGSIIRKWNGLLSAMADADHFDIHFPLDLDVKMKAMIFGACFLIDFMYFERSPPQRSR 12BE86728D54F794 pls3_human Phospholipid scramblase 3 Ca(2+)-dependent phospholipid scramblase 3 PLSCR3 protein protein human Homo sapiens Human MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAVTS B53AAA8166E6D99E pdcd6-plscr3-1 6 16 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey physical association physical association We performed a co-immunoprecipitation assay by overexpressing GFP-fused PLSCR3, GFP-Alix (positive control), and GFP (negative control), respectively, in HEK293 cells. Fig. 2A Interaction is calcium dependent EGTA (Ca2+ chelator) pdcd6-pdcd6ip-1 6 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association We performed a co-immunoprecipitation assay by overexpressing GFP-fused PLSCR3, GFP-Alix (positive control), and GFP (negative control), respectively, in HEK293 cells. Fig. 2A EGTA (Ca2+ chelator) Interaction is Ca2+ dependent pdcd6-plscr3-2 3 16 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction In a separate experiment, we performed an overlay assay using biotin-labeled ALG-2 (bio-ALG-2) as a probe. As shown in Fig. 2B, the immunoprecipitate of GFP-PLSCR3, but not that of GFP, presented a specific band, Fig. 2B Interaction performed in the presence of calcium pdcd6-plscr3-3 7 16 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association As shown in Fig. 2E, PLSCR3 was detected in the immunoprecipitates by anti-ALG-2 pAb ({alpha}-ALG-2) but not by control IgG. Fig. 2E Q9NRY6 transfection; EGTA (Ca2+ chelator) pdcd6-plscr3-4 2 10 unspecified role unspecified role bait bait O75340:p.[Glu47Ala;Glu114Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain E A Fri Jul 22 11:04:51 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu114ala,glu47ala' Wed May 02 18:57:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu47ala,glu114ala' Tue Jun 30 19:41:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu47Ala;Glu114Ala]' ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association In Western blot analysis using anti-GFP mAb, a GFP-PLSCR3 band was not detected in the pelleted bead fraction (pulldown products) of GST-ALG-2E47A/114A in the presence or absence of Ca2+ in the binding buffer (Fig. 3A). Fig. 3A, 3B Interaction is calcium dependent EGTA (Ca2+ chelator) pdcd6-plscr3-5 2 16 unspecified role unspecified role prey prey abs-1 region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined abs-2 region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role bait bait O75340:p.Trp57Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A Wed May 02 16:10:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp57ala' Tue Jun 30 18:54:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp57Ala' gly121_phe122 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O75340:p.Tyr91Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:00:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr91ala' Tue Jun 30 19:44:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr91Ala' O75340:p.Phe60Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 14:58:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe60ala' Tue Jun 30 17:02:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe60Ala' O75340:p.Tyr180Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 20:06:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr180ala' Tue Jun 30 20:02:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr180Ala' O75340:p.Trp95Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A Wed May 02 16:16:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp95ala' Tue Jun 30 18:08:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp95Ala' ecoli Escherichia coli (strain K12) 42 45 physical association physical association In Western blot analysis using anti-GFP mAb, a GFP-PLSCR3 band was not detected in the pelleted bead fraction (pulldown products) of GST-ALG-2E47A/114A in the presence or absence of Ca2+ in the binding buffer (Fig. 3A). Fig. 3C Interaction is calcium dependent EGTA (Ca2+ chelator) Phe60ala mutant disrupts binding in absence of either ABS-1 or ABS-2 region. All other mutants only effective in absence of ABS-2. pdcd6-plscr3-6 8 16 unspecified role unspecified role bait bait lys tagged region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined abs-2 region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q9NRY6:p.[Phe49Ala;Phe52Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain F A Fri Jul 22 11:03:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'phe52ala,phe49ala' Wed May 02 19:37:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe49ala,phe52ala' Tue Jun 30 18:19:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe49Ala;Phe52Ala]' Q9NRY6:p.[Pro43Ala;Pro45Ala;Pro47Ala;Pro53Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A Fri Jul 22 10:54:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'pro45ala,pro47ala,pro43ala,pro53ala' Wed May 02 15:17:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro43ala,pro45ala,pro47ala,pro53ala' Tue Jun 30 17:35:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro43Ala;Pro45Ala;Pro47Ala;Pro53Ala]' Q9NRY6:p.Phe49Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 20:31:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe49ala' Tue Jun 30 20:10:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe49Ala' Q9NRY6:p.Phe49Tyr mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F Y Wed May 02 14:31:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe49tyr' Tue Jun 30 18:18:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe49Tyr' Q9NRY6:p.Phe49Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F L Wed May 02 17:58:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe49leu' Tue Jun 30 19:53:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe49Leu' in vitro In vitro 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 60 53 physical association physical association Affinity purification of recombinant ALG-2 proteins using an ABS-2 oligopeptide-immobilized column. Figs. 4 and 6 Interaction occurred in the presence of calcium pdcd6-plscr3-7 5 16 unspecified role unspecified role bait bait n-terminal biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range abs-1 region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain gly121_phe122 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association We performed a co-immunoprecipitation assay by overexpressing GFP-fused PLSCR3, GFP-Alix (positive control), and GFP (negative control), respectively, in HEK293 cells. Fig. 5, Supp. Fig 2 [Ca2+]1/2: full length PDCD6 = 5.1uM; PDCD6 (24-191) = 6.7uM pH 7.4, Temp=25C KD derived in 50mM Ca2+ pdcd6-plscr3-8 5 16 unspecified role unspecified role bait bait n-terminal biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range abs-2 region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association We performed a co-immunoprecipitation assay by overexpressing GFP-fused PLSCR3, GFP-Alix (positive control), and GFP (negative control), respectively, in HEK293 cells. Fig. 5, Supp. Fig. 2 [Ca2+]1/2: full length PDCD6 = 3.7uM; PDCD6 (24-191) = 4.7uM pH 7.4, Temp=25C KD derived in 50mM Ca2+ pdcd6-pdcd6ip-2 2 9 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gly121-phe122 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction GST-ALG-2{Delta}GF122 did not pull down GFP-Alix Figs. 3B EGTA (Ca2+ chelator) Interaction is Ca2+ dependent pdcd6-pdcd6ip-3 1 9 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gly121-phe122 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O75340:p.Trp57Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A Wed May 02 18:18:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp57ala' Tue Jun 30 18:35:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp57Ala' O75340:p.Phe60Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 15:52:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe60ala' Tue Jun 30 17:36:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe60Ala' O75340:p.Tyr91Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:52:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr91ala' Tue Jun 30 18:13:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr91Ala' O75340:p.Trp95Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A Wed May 02 19:54:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp95ala' Tue Jun 30 16:39:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp95Ala' O75340:p.Tyr180Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 20:32:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr180ala' Tue Jun 30 19:40:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr180Ala' ecoli Escherichia coli (strain K12) physical association physical association GST-ALG-2{Delta}GF122 did not pull down GFP-Alix Fig 7B pdcd6-plscr4-1 2 10 unspecified role unspecified role bait bait O75340:p.[Glu47Ala;Glu114Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A certain certain sequence position certain certain certain sequence position certain E A Fri Jul 22 11:08:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'glu114ala,glu47ala' Wed May 02 17:29:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu47ala,glu114ala' Tue Jun 30 20:11:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Glu47Ala;Glu114Ala]' ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association On the other hand, clear bands were detected for GFP-PLSCR4 by pulldown assay with GST-ALG-2 as well as GST-ALG-2{Delta}GF122. Fig. 7A pdcd6-anxa7-1 1 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gly121-phe122 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O75340:p.Trp57Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A Wed May 02 20:10:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp57ala' Tue Jun 30 19:12:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp57Ala' O75340:p.Phe60Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 18:37:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe60ala' Tue Jun 30 17:25:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe60Ala' O75340:p.Tyr91Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 16:08:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr91ala' Tue Jun 30 18:16:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr91Ala' O75340:p.Trp95Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A Wed May 02 19:01:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp95ala' Tue Jun 30 19:35:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp95Ala' O75340:p.Tyr180Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 19:46:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr180ala' Tue Jun 30 16:41:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr180Ala' ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Fig 7B pdcd6-anxa11-1 1 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gly121-phe122 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O75340:p.Trp57Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A Wed May 02 16:54:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp57ala' Tue Jun 30 19:50:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp57Ala' O75340:p.Phe60Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 17:09:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe60ala' Tue Jun 30 18:36:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe60Ala' O75340:p.Tyr91Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 17:50:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr91ala' Tue Jun 30 19:31:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr91Ala' O75340:p.Trp95Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A Wed May 02 15:43:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp95ala' Tue Jun 30 17:35:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp95Ala' O75340:p.Tyr180Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 16:10:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr180ala' Tue Jun 30 19:48:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr180Ala' ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Fig 7B pdcd6-tsg101-1 1 10 unspecified role unspecified role bait bait gly121-phe122 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O75340:p.Trp95Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A Wed May 02 16:24:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp95ala' Tue Jun 30 15:35:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp95Ala' O75340:p.Tyr180Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 18:57:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr180ala' Tue Jun 30 19:47:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr180Ala' ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Fig 7B pdcd6-sec31a-4 1 14 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gly121-phe122 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O75340:p.Phe60Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 17:42:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe60ala' Tue Jun 30 19:57:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe60Ala' ecoli Escherichia coli (strain K12) physical association physical association Fig 7B pdcd6-plscr3-9 4 16 unspecified role unspecified role bait bait abs-1 region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 10 unspecified role unspecified role prey prey region biotin tag biotin tag deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association After varying amounts of the ABS-1 oligopeptide and its Thr21-phosphorylated oligopeptide (ABS-1-pT) were immobilized to the plates, binding to bio-ALG-2 was measured by reactivity of SA-peroxidase. Fig. 8 Interaction inhibited by phosphorylation on Thr-21 of PLSCR3.