IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A yeast two-hybrid system reconstituting substrate recognition of the von Hippel-Lindau tumor suppressor protein. A yeast two-hybrid system reconstituting substrate recognition of the von Hippel-Lindau tumor suppressor protein. Nucleic Acids Res. (0305-1048) 2007 Bex C., Knauth K., Dambacher S., Buchberger A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer The Y2H system was modified to reconstitute the physical interaction between pVHL and its substrates. The BD-pVHL bait and prey fusions are expressed from the pBridge and pACT2 vectors under the control of the constitutive PADH1 promoter. The pBridge vector in addition allows for the expression of PHD1, 2 or 3 under the control of the PMET25 promoter, which is induced in the absence of methionine. The yeast reporter strain CG1945BC is a derivative of CG1945 expressing ELB and ELC under the control of the constitutive PPGK1 promoter. This allows reporter gene activation by the PHD-, ELB-, ELC-dependent interaction between BD-pVHL and AD-prey. buchberg@biochem.mpg.de 27-Aug-2008: Contacted by JYOTI. davet yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bex C., Knauth K., Dambacher S., Buchberger A. Apoptosis - Interactions involving proteins with a function related to apoptosis The Y2H system was modified to reconstitute the physical interaction between pVHL and its substrates. The BD-pVHL bait and prey fusions are expressed from the pBridge and pACT2 vectors under the control of the constitutive PADH1 promoter. The pBridge vector in addition allows for the expression of PHD1, 2 or 3 under the control of the PMET25 promoter, which is induced in the absence of methionine. The yeast reporter strain CG1945BC is a derivative of CG1945 expressing ELB and ELC under the control of the constitutive PPGK1 promoter. This allows reporter gene activation by the PHD-, ELB-, ELC-dependent interaction between BD-pVHL and AD-prey. buchberg@biochem.mpg.de Accepted 2008-SEP-5 by DAVET. 27-Aug-2008: Contacted by JYOTI. A human testis cDNA library was used. Nucleic Acids Res. (0305-1048) 2007 davet A yeast two-hybrid system reconstituting substrate recognition of the von Hippel-Lindau tumor suppressor protein. A yeast two-hybrid system reconstituting substrate recognition of the von Hippel-Lindau tumor suppressor protein. Nucleic Acids Res. (0305-1048) 2007 Bex C., Knauth K., Dambacher S., Buchberger A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer The Y2H system was modified to reconstitute the physical interaction between pVHL and its substrates. The BD-pVHL bait and prey fusions are expressed from the pBridge and pACT2 vectors under the control of the constitutive PADH1 promoter. The pBridge vector in addition allows for the expression of PHD1, 2 or 3 under the control of the PMET25 promoter, which is induced in the absence of methionine. The yeast reporter strain CG1945BC is a derivative of CG1945 expressing ELB and ELC under the control of the constitutive PPGK1 promoter. This allows reporter gene activation by the PHD-, ELB-, ELC-dependent interaction between BD-pVHL and AD-prey. buchberg@biochem.mpg.de 27-Aug-2008: Contacted by JYOTI. davet yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bex C., Knauth K., Dambacher S., Buchberger A. Apoptosis - Interactions involving proteins with a function related to apoptosis The Y2H system was modified to reconstitute the physical interaction between pVHL and its substrates. The BD-pVHL bait and prey fusions are expressed from the pBridge and pACT2 vectors under the control of the constitutive PADH1 promoter. The pBridge vector in addition allows for the expression of PHD1, 2 or 3 under the control of the PMET25 promoter, which is induced in the absence of methionine. The yeast reporter strain CG1945BC is a derivative of CG1945 expressing ELB and ELC under the control of the constitutive PPGK1 promoter. This allows reporter gene activation by the PHD-, ELB-, ELC-dependent interaction between BD-pVHL and AD-prey. buchberg@biochem.mpg.de Accepted 2008-SEP-5 by DAVET. Nucleic Acids Res. (0305-1048) 2007 davet A yeast two-hybrid system reconstituting substrate recognition of the von Hippel-Lindau tumor suppressor protein. A yeast two-hybrid system reconstituting substrate recognition of the von Hippel-Lindau tumor suppressor protein. Nucleic Acids Res. (0305-1048) 2007 Bex C., Knauth K., Dambacher S., Buchberger A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer The Y2H system was modified to reconstitute the physical interaction between pVHL and its substrates. The BD-pVHL bait and prey fusions are expressed from the pBridge and pACT2 vectors under the control of the constitutive PADH1 promoter. The pBridge vector in addition allows for the expression of PHD1, 2 or 3 under the control of the PMET25 promoter, which is induced in the absence of methionine. The yeast reporter strain CG1945BC is a derivative of CG1945 expressing ELB and ELC under the control of the constitutive PPGK1 promoter. This allows reporter gene activation by the PHD-, ELB-, ELC-dependent interaction between BD-pVHL and AD-prey. buchberg@biochem.mpg.de 27-Aug-2008: Contacted by JYOTI. davet human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bex C., Knauth K., Dambacher S., Buchberger A. Apoptosis - Interactions involving proteins with a function related to apoptosis The Y2H system was modified to reconstitute the physical interaction between pVHL and its substrates. The BD-pVHL bait and prey fusions are expressed from the pBridge and pACT2 vectors under the control of the constitutive PADH1 promoter. The pBridge vector in addition allows for the expression of PHD1, 2 or 3 under the control of the PMET25 promoter, which is induced in the absence of methionine. The yeast reporter strain CG1945BC is a derivative of CG1945 expressing ELB and ELC under the control of the constitutive PPGK1 promoter. This allows reporter gene activation by the PHD-, ELB-, ELC-dependent interaction between BD-pVHL and AD-prey. buchberg@biochem.mpg.de Accepted 2008-SEP-5 by DAVET. 27-Aug-2008: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2007 davet thoc1_human THO complex subunit 1 hTREX84 THOC1 HPR1 Nuclear matrix protein p84 protein protein human Homo sapiens Human MSPTPPLFSLPEARTRFTKSTREALNNKNIKPLLSTFSQVPGSENEKKCTLDQAFRGILEEEIINHSSCENVLAIISLAIGGVTEGICTASTPFVLLGDVLDCLPLDQCDTIFTFVEKNVATWKSNTFYSAGKNYLLRMCNDLLRRLSKSQNTVFCGRIQLFLARLFPLSEKSGLNLQSQFNLENVTVFNTNEQESTLGQKHTEDREEGMDVEEGEMGDEEAPTTCSIPIDYNLYRKFWSLQDYFRNPVQCYEKISWKTFLKYSEEVLAVFKSYKLDDTQASRKKMEELKTGGEHVYFAKFLTSEKLMDLQLSDSNFRRHILLQYLILFQYLKGQVKFKSSNYVLTDEQSLWIEDTTKSVYQLLSENPPDGERFSKMVEHILNTEENWNSWKNEGCPSFVKERTSDTKPTRIIRKRTAPEDFLGKGPTKKILMGNEELTRLWNLCPDNMEACKSETREHMPTLEEFFEEAIEQADPENMVENEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENESPDVRRDKPVTGEQIEVFANKLGEQWKILAPYLEMKDSEIRQIECDSEDMKMRAKQLLVAWQDQEGVHATPENLINALNKSGLSDLAESLTNDNETNS DB7980BD0F252DAB vhl_human von Hippel-Lindau disease tumor suppressor VHL pVHL Protein G7 protein protein human Homo sapiens Human MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD DIP protein P40337 original sequence version: 176 DIP protein P40337 original sequence version: 103 DIP protein P40337-1 original sequence version: 177 DIP protein P40337 original sequence version: 160 DIP protein P40337 original sequence version: 175 BA5D6765FBC16EA7 elob_human Elongin-B ELOB Elongin 18 kDa subunit RNA polymerase II transcription factor SIII subunit B SIII p18 TCEB2 Transcription elongation factor B polypeptide 2 protein protein human Homo sapiens Human MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ C045F58FBED0EC47 kif2c_human Kinesin-like protein KIF2C KNSL6 KIF2C Mitotic centromere-associated kinesin Kinesin-like protein 6 protein protein human Homo sapiens Human MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSELRITAQENDMEVELPAAANSRKQFSVPPAPTRPSCPAVAEIPLRMVSEEMEEQVHSIRGSSSANPVNSVRRKSCLVKEVEKMKNKREEKKAQNSEMRMKRAQEYDSSFPNWEFARMIKEFRATLECHPLTMTDPIEEHRICVCVRKRPLNKQELAKKEIDVISIPSKCLLLVHEPKLKVDLTKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQTGSGKTHTMGGDLSGKAQNASKGIYAMASRDVFLLKNQPCYRKLGLEVYVTFFEIYNGKLFDLLNKKAKLRVLEDGKQQVQVVGLQEHLVNSADDVIKMIDMGSACRTSGQTFANSNSSRSHACFQIILRAKGRMHGKFSLVDLAGNERGADTSSADRQTRMEGAEINKSLLALKECIRALGQNKAHTPFRESKLTQVLRDSFIGENSRTCMIATISPGISSCEYTLNTLRYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNLSKEEEELSSQMSSFNEAMTQIRELEEKAMEELKEIIQQGPDWLELSEMTEQPDYDLETFVNKAESALAQQAKHFSALRDVIKALRLAMQLEEQASRQISSKKRPQ 5BDECC133AB4B55C eloc_human Elongin-C ELOC Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 TCEB1 Transcription elongation factor B polypeptide 1 protein protein human Homo sapiens Human MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 98D88696E883538B q93062-3 RNA-binding protein with multiple splicing RBPMS HERMES Heart and RRM expressed sequence protein protein human Homo sapiens Human MNNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGTPNPSTPLPNTVPQFIAREPYELTVPALYPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQCFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC 700E9B9FA7682FAD egln1_human Egl nine homolog 1 EGLN1 C1orf12 PNAS-118 PNAS-137 Hypoxia-inducible factor prolyl hydroxylase 2 Prolyl hydroxylase domain-containing protein 2 SM-20 protein protein human Homo sapiens Human MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQGSEGALGHGVGPHQHSGPAPPAAVPPPRAGAREPRKAAARRDNASGDAAKGKVKAKPPADPAAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF 81A97FF772CAA14C fkbp8_human Peptidyl-prolyl cis-trans isomerase FKBP8 FK506-binding protein 8 38 kDa FK506-binding protein FKBPR38 FKBP8 FKBP38 Rotamase protein protein human Homo sapiens Human MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN DIP protein Q14318 original sequence version: 145 887C25ADE71EBA8D dgki_human Diacylglycerol kinase iota DGKI protein protein human Homo sapiens Human MDAAGRGCHLLPLPAARGPARAPAAAAAAAASPPGPCSGAACAPSAAAGAGAMNPSSSAGEEKGATGGSSSSGSGAGSCCLGAEGGADPRGAGSAAAAGAAALDEPAAAGQKEKDEALEEKLRNLTFRKQVSYRKAISRAGLQHLAPAHPLSLPVANGPAKEPRATLDWSENAVNGEHLWLETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREGGSRSPRENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCFMLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGMEQENKGRPFVIKPISSPLMKPLLVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALELYRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDEPVSKILCQVEDGTVVQLDRWNLHVERNPDLPPEELEDGVCKLPLNVFNNYFSLGFDAHVTLEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQELKFQCIVFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLNDPQSVPDRLRIRVNKISLQDYEGFHYDKEKLREASISDWLRTIAGELVQSFGAIPLGILVVRGDCDLETCRMYIDRLQEDLQSVSSGSQRVHYQDHETSFPRALSAQRLSPRWCFLDDRSQEHLHFVMEISQDEIFILDPDMVVSQPAGTPPGMPDLVVEQASGISDWWNPALRKRMLSDSGLGMIAPYYEDSDLKDLSHSRVLQSPVSSEDHAILQAVIAGDLMKLIESYKNGGSLLIQGPDHCSLLHYAAKTGNGEIVKYILDHGPSELLDMADSETGETALHKAACQRNRAVCQLLVDAGASLRKTDSKGKTPQERAQQAGDPDLAAYLESRQNYKVIGHEDLETAV B84971AA7630A799 egln2_human Prolyl hydroxylase EGLN2 Hypoxia-inducible factor prolyl hydroxylase 1 HPH-3 Prolyl hydroxylase domain-containing protein 1 Estrogen-induced tag 6 EGLN2 EIT6 Egl nine homolog 2 protein protein human Homo sapiens Human MDSPCQPQPLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRLAAQGARPEAPKRKWAEDGGDAPSPSKRPWARQENQEAEREGGMSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGCRSIGALMAHVDAVIRHCAGRLGSYVINGRTKAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLNQNWDVKVHGGLLQIFPEGRPVVANIEPLFDRLLIFWSDRRNPHEVKPAYATRYAITVWYFDAKERAAAKDKYQLASGQKGVQVPVSQPPTPT F172E9B0482C9CF3 hif1a_human Hypoxia-inducible factor 1-alpha ARNT-interacting protein Member of PAS protein 1 Basic-helix-loop-helix-PAS protein MOP1 HIF1A MOP1 BHLHE78 PASD8 PAS domain-containing protein 8 Class E basic helix-loop-helix protein 78 protein protein human Homo sapiens Human MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVTVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN DIP protein Q16665 original sequence version: 94 DIP protein Q16665 original sequence version: 98 DIP protein Q16665-1 original sequence version: 102 DIP protein Q16665 original sequence version: 102 DIP protein Q16665 original sequence version: 127 DIP protein Q16665 original sequence version: 120 DIP protein Q16665 original sequence version: 169 DIP protein Q16665 original sequence version: 174 DIP protein Q16665-1 original sequence version: 174 DIP protein Q16665-1 original sequence version: 191 DIP protein Q16665 original sequence version: 191 DIP protein Q16665 original sequence version: 179 DIP protein Q16665 original sequence version: 150 DIP protein Q16665 original sequence version: 156 DIP protein Q16665 original sequence version: 177 ABD4F7DAA135BE2D p40337-3 von Hippel-Lindau disease tumor suppressor VHL19 VHLp18(MEA) VHL Protein G7 pVHL protein protein human Homo sapiens Human MEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD Produced by alternative initiation at Met-54 of isoform 1. 2644C3B8C3A87D64 egln3_human Prolyl hydroxylase EGLN3 Hypoxia-inducible factor prolyl hydroxylase 3 HPH-1 Prolyl hydroxylase domain-containing protein 3 EGLN3 Egl nine homolog 3 protein protein human Homo sapiens Human MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED 9DA3A0F80168557B can7_human Calpain-7 CAPN7 PALBH PalB homolog protein protein human Homo sapiens Human MDATALERDAVQFARLAVQRDHEGRYSEAVFYYKEAAQALIYAEMAGSSLENIQEKITEYLERVQALHSAVQSKSADPLKSKHQLDLERAHFLVTQAFDEDEKENVEDAIELYTEAVDLCLKTSYETADKVLQNKLKQLARQALDRAEALSEPLTKPVGKISSTSVKPKPPPVRAHFPLGANPFLERPQSFISPQSCDAQGQRYTAEEIEVLRTTSKINGIEYVPFMNVDLRERFAYPMPFCDRWGKLPLSPKQKTTFSKWVRPEDLTNNPTMIYTVSSFSIKQTIVSDCSFVASLAISAAYERRFNKKLITGIIYPQNKDGEPEYNPCGKYMVKLHLNGVPRKVIIDDQLPVDHKGELLCSYSNNKSELWVSLIEKAYMKVMGGYDFPGSNSNIDLHALTGWIPERIAMHSDSQTFSKDNSFRMLYQRFHKGDVLITASTGMMTEAEGEKWGLVPTHAYAVLDIREFKGLRFIQLKNPWSHLRWKGRYSENDVKNWTPELQKYLNFDPRTAQKIDNGIFWISWDDLCQYYDVIYLSWNPGLFKESTCIHSTWDAKQGPVKDAYSLANNPQYKLEVQCPQGGAAVWVLLSRHITDKDDFANNREFITMVVYKTDGKKVYYPADPPPYIDGIRINSPHYLTKIKLTTPGTHTFTLVVSQYEKQNTIHYTVRVYSACSFTFSKIPSPYTLSKRINGKWSGQSAGGCGNFQETHKNNPIYQFHIEKTGPLLIELRGPRQYSVGFEVVTVSTLGDPGPHGFLRKSSGDYRCGFCYLELENIPSGIFNIIPSTFLPKQEGPFFLDFNSIIPIKITQLQ 814769611360D281 rbcc1_human RB1-inducible coiled-coil protein 1 RB1CC1 KIAA0203 RBICC FAK family kinase-interacting protein of 200 kDa protein protein human Homo sapiens Human MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVCTYSAGTDTNPIFLFNKEMILCDRPPAIPKTTFSTENDMEIKVEESLMMPAVFHTVASRTQLALEMYEVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQSIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRLDSLPEHEDSEKAEMKRSTELVLSPDMPRTTNESLLTSFPKSVEHVSPDTADAESGKEIRESCQSTVHQQDETTIDTKDGDLPFFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPRIIRPFIAECRQTIAKLDNQNMKAIKGLEDRLYALDQMIASCGRLVNEQKELAQGFLANQKRAENLKDASVLPDLCLSHANQLMIMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFVMLHADQDGEKLQALLRLVIELLERVKIVEALSTVPQMYCLAVVEVVRRKMFIKHYREWAGALVKDGKRLYEAEKSKRESFGKLFRKSFLRNRLFRGLDSWPPSFCTQKPRKFDCELPDISLKDLQFLQSFCPSEVQPFLRVPLLCDFEPLHQHVLALHNLVKAAQSLDEMSQTITDLLSEQKASVSQTSPQSASSPRMESTAGITTTTSPRTPPPLTVQDPLCPAVCPLEELSPDSIDAHTFDFETIPHPNIEQTIHQVSLDLDSLAESPESDFMSAVNEFVIEENLSSPNPISDPQSPEMMVESLYSSVINAIDSRRMQDTNVCGKEDFGDHTSLNVQLERCRVVAQDSHFSIQTIKEDLCHFRTFVQKEQCDFSNSLKCTAVEIRNIIEKVKCSLEITLKEKHQKELLSLKNEYEGKLDGLIKETEENENKIKKLKGELVCLEEVLQNKDNEFALVKHEKEAVICLQNEKDQKLLEMENIMHSQNCEIKELKQSREIVLEDLKKLHVENDEKLQLLRAELQSLEQSHLKELEDTLQVRHIQEFEKVMTDHRVSLEELKKENQQIINQIQESHAEIIQEKEKQLQELKLKVSDLSDTRCKLEVELALKEAETDEIKILLEESRAQQKETLKSLLEQETENLRTEISKLNQKIQDNNENYQVGLAELRTLMTIEKDQCISELISRHEEESNILKAELNKVTSLHNQAFEIEKNLKEQIIELQSKLDSELSALERQKDEKITQQEEKYEAIIQNLEKDRQKLVSSQEQDREQLIQKLNCEKDEAIQTALKEFKLEREVVEKELLEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMETSMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV DIP protein Q8TDY2 original sequence version: 85 DIP protein Q8TDY2 original sequence version: 95 DIP protein Q8TDY2 original sequence version: 98 DIP protein Q8TDY2 original sequence version: 107 C9C90A328875016A q9h869-3 YY1-associated protein 1 YY1AP1 HCCA2 YY1AP Hepatocellular carcinoma susceptibility protein Hepatocellular carcinoma-associated protein 2 protein protein human Homo sapiens Human MGFSNMEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEASSTRICLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMYPELLPVCSLKAKNPQDKILFTKAEDNLLALGLKHFEGTEFLNPLISKYLLTCKTARQLTVRIKNLNMNRAPDNIIKFYKKTKQLPVLGKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDQGLEKDNSELGSETRYPLLLPKGVVLKLKPVADRFPKKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPAQSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESPAALPAMPPEARTSFPLSESQTLLSSAPVPKVMMPSPASSMFRKPYVRRRPSKRRGARAFRCIKPAPVIHPASVIFTVPATTVKIVSLGGGCNMIQPVNAAVAQSPQTIPIATLLVNPTSFPCPLNQPLVASSVSPLIVSGNSVNLPIPSTPEDKAHMNVDIACAVADGENAFQGLEPKLEPQELSPLSATVFPKVEHSPGPPPVDKQCQEGLSENSAYRWTVVKTEEGRQALEPLPQGIQESLNNSSPGDLEEVVKMEPEDATEEISGFL AEE39032FCC83A53 epas1_human Endothelial PAS domain-containing protein 1 EPAS1 HIF2A MOP2 Member of PAS protein 2 Basic-helix-loop-helix-PAS protein MOP2 BHLHE73 PASD2 Hypoxia-inducible factor 2-alpha HIF-1-alpha-like factor PAS domain-containing protein 2 Class E basic helix-loop-helix protein 73 protein protein human Homo sapiens Human MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQNFEESSAYGKAILPPSQPWATELRSHSTQSEAGSLPAFTVPQAAAPGSTTPSATSSSSSCSTPNSPEDYYTSLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT DIP protein Q99814 original sequence version: 115 DIP protein Q99814 original sequence version: 155 DIP protein Q99814 original sequence version: 157 DIP protein Q99814 original sequence version: 137 DIP protein Q99814 original sequence version: 135 4838989598234FC1 vhl-hif1a 2 13 unspecified role unspecified role ancillary ancillary 15 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey Q16665:p.[Pro402Ala;Pro564Gly] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P G Wed May 02 16:45:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro402ala,pro564gly' Tue Jun 30 17:05:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro402Ala;Pro564Gly]' pro402 (required) hy2res dihydroxylated residue Dioxidation Hy2Res dihydroxy certain certain sequence position certain certain certain sequence position certain pro564 (required) hy2res dihydroxylated residue Dioxidation Hy2Res dihydroxy certain certain sequence position certain certain certain sequence position certain physical association physical association 2 A, 4 we observed a robust interaction between pVHL and HIF1a that was strictly dependent on the presence of one of the three PHDs This interaction was absolutely dependent on the presence of one of the three prolylhydroxylases (PHDs) (PHD1-3). The isoform of VHL used as the interactor has aa 1-53 missing, so corresponding to the construct used. vhl-tceb1-1 1 15 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 This interaction was not dependent upon the presence of a prolylhydroxylase. Among the true-positive interactors, multiple full-length cDNAs of ELC and ELB were identified that mediated a PHD3-independent interaction with pVHL The isoform of VHL used as the interactor has aa 1-53 missing, so corresponding to the construct used. vhl-tceb2-1 1 15 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 This interaction was not dependent upon the presence of a prolylhydroxylase. Among the true-positive interactors, multiple full-length cDNAs of ELC and ELB were identified that mediated a PHD3-independent interaction with pVHL The isoform of VHL used as the interactor has aa 1-53 missing, so corresponding to the construct used. vhl-hif1a-1 1 16 unspecified role unspecified role ancillary ancillary 15 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey pro402 (required) hy2res dihydroxylated residue Dioxidation Hy2Res dihydroxy certain certain sequence position certain certain certain sequence position certain pro564 (required) sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 This interaction was dependent upon the presence of the prolylhydroxylase PHD3. All HIF1/2a fragments spanned one of the two critical prolyl residues and mediated an interaction with pVHL that was entirely dependent on PHD3, ELB and ELC The isoform of VHL used as the interactor has aa 1-53 missing, so corresponding to the construct used. vhl-epas1 1 16 unspecified role unspecified role ancillary ancillary 15 unspecified role unspecified role bait bait 20 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 This interaction was dependent upon the presence of the prolylhydroxylase PHD3. All HIF1/2a fragments spanned one of the two critical prolyl residues and mediated an interaction with pVHL that was entirely dependent on PHD3, ELB and ELC The isoform of VHL used as the interactor has aa 1-53 missing, so corresponding to the construct used. vhl-dgki 1 16 unspecified role unspecified role ancillary ancillary 15 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 This interaction was dependent upon the presence of the prolylhydroxylase PHD3. In a proof-of-principle Y2H screen, we identified the known substrates HIF1/2a and new candidate substrates including diacylglycerol kinase iota, demonstrating that our strategy allows detection of stable interactions between pVHL and otherwise elusive cellular targets. The isoform of VHL used as the interactor has aa 1-53 missing, so corresponding to the construct used. vhl-kif2c 1 16 unspecified role unspecified role ancillary ancillary 15 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 This interaction was dependent upon the presence of the prolylhydroxylase PHD3. The isoform of VHL used as the interactor has aa 1-53 missing, so corresponding to the construct used. vhl-thoc1 1 16 unspecified role unspecified role ancillary ancillary 15 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 This interaction was dependent upon the presence of the prolylhydroxylase PHD3. The isoform of VHL used as the interactor has aa 1-53 missing, so corresponding to the construct used. vhl-capn7 1 16 unspecified role unspecified role ancillary ancillary 15 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 This interaction was dependent upon the presence of the prolylhydroxylase PHD3. The isoform of VHL used as the interactor has aa 1-53 missing, so corresponding to the construct used. vhl-yy1ap1 1 16 unspecified role unspecified role ancillary ancillary 15 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 This interaction was dependent upon the presence of the prolylhydroxylase PHD3. The prey YY1AP1 is stated to be 739 aa in length as it is a C-terminal fragment. Isoform 3 in the UniProtKB entry for YY1AP1 corresponds to this length. The isoform of VHL used as the interactor has aa 1-53 missing, so corresponding to the construct used. vhl-rbpms 1 16 unspecified role unspecified role ancillary ancillary 15 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 This interaction was dependent upon the presence of the prolylhydroxylase PHD3. The isoform of VHL used as the interactor has aa 1-53 missing, so corresponding to the construct used. vhl-rb1cc1 1 16 unspecified role unspecified role ancillary ancillary 15 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 This interaction was dependent upon the presence of the prolylhydroxylase PHD3. The isoform of VHL used as the interactor has aa 1-53 missing, so corresponding to the construct used. vhl-fkbp8 1 16 unspecified role unspecified role ancillary ancillary 15 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 This interaction was dependent upon the presence of the prolylhydroxylase PHD3. The isoform of VHL used as the interactor has aa 1-53 missing, so corresponding to the construct used. vhl-dgki-1 2 15 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O75912:p.Pro903Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Wed May 02 17:37:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro903ala' Tue Jun 30 17:55:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro903Ala' O75912:p.[Pro147Ala;Pro903Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 14:51:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro147ala,pro903ala' Tue Jun 30 18:40:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro147Ala;Pro903Ala]' physical association physical association 4 A, B, 5 This interaction was dependent upon the presence of the prolylhydroxylase PHD3. There was only a weak interaction in the presence of PHD1 or PHD2. While full-length DGKi1-1065 interacted with pVHL in a PHD3- and ELB/ELC-dependent manner (Figure 4b), C-terminally truncated variants lacking the LxxLAP motif at Pro903 failed to interact, demonstrating that the C-terminal LxxLAP motif is required for the interaction with pVHL. The isoform of VHL used as the interactor has aa 1-53 missing, so corresponding to the construct used. vhl-dgki-2 3 15 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 293T cells were transiently transfected with expression plasmids for fulllength DGKi and the long and short isoforms of pVHL, respectively. DGKi was efficiently co-immunoprecipitated with both pVHL isoforms The isoform of VHL used as the interactor has aa 1-53 missing. vhl-dgki-3 3 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 293T cells were transiently transfected with expression plasmids for fulllength DGKi and the long and short isoforms of pVHL, respectively. DGKi was efficiently co-immunoprecipitated with both pVHL isoforms vhl-hif1a-2 2 10 unspecified role unspecified role ancillary ancillary 14 unspecified role unspecified role prey prey Q16665:p.[Pro402Ala;Pro564Gly] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P G Wed May 02 15:32:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro402ala,pro564gly' Tue Jun 30 19:56:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro402Ala;Pro564Gly]' 15 unspecified role unspecified role bait bait physical association physical association 2 A, 4 we observed a robust interaction between pVHL and HIF1a that was strictly dependent on the presence of one of the three PHDs This interaction was absolutely dependent on the presence of one of the three prolylhydroxylases (PHDS) (PHD1-3). The isoform of VHL used as the interactor has aa 1-53 missing, so corresponding to the construct used. vhl-hif1a-3 2 15 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey Q16665:p.[Pro402Ala;Pro564Gly] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P G Wed May 02 17:37:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro402ala,pro564gly' Tue Jun 30 19:47:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro402Ala;Pro564Gly]' 16 unspecified role unspecified role ancillary ancillary physical association physical association 2 A, 4 we observed a robust interaction between pVHL and HIF1a that was strictly dependent on the presence of one of the three PHDs This interaction was absolutely dependent on the presence of one of the three prolylhydroxylases (PHDS) (PHD1-3). The isoform of VHL used as the interactor has aa 1-53 missing, so corresponding to the construct used.