IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Human C-reactive protein binds activating Fcgamma receptors and protects myeloma tumor cells from apoptosis. Human C-reactive protein binds activating Fcgamma receptors and protects myeloma tumor cells from apoptosis. Cancer Cell (1535-6108) 2007 imex curation Yang J., Wezeman M., Zhang X., Lin P., Wang M., Qian J., Wan B., Kwak LW., Yu L., Yi Q. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Some interactions could not be curated as the antibodies used did not distiguish between FcgammaRII isoforms. Also it is not clear what cell type the CRP was expressed in. qyi@mdanderson.org 13-Nov-2007: Contacted by JYOTI. orchard Only protein-protein interactions 3 human-mm1_144 Homo sapiens myeloma cell line MM1-144 mm1_144 Human myeloma cell line MM1-144 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang J., Wezeman M., Zhang X., Lin P., Wang M., Qian J., Wan B., Kwak LW., Yu L., Yi Q. Apoptosis - Interactions involving proteins with a function related to apoptosis Some interactions could not be curated as the antibodies used did not distiguish between FcgammaRII isoforms. Also it is not clear what cell type the CRP was expressed in. qyi@mdanderson.org Accepted 2007-NOV-3 by ORCHARD. 13-Nov-2007: Contacted by JYOTI. Cancer Cell (1535-6108) 2007 orchard Only protein-protein interactions 3 imex curation Human C-reactive protein binds activating Fcgamma receptors and protects myeloma tumor cells from apoptosis. Human C-reactive protein binds activating Fcgamma receptors and protects myeloma tumor cells from apoptosis. Cancer Cell (1535-6108) 2007 imex curation Yang J., Wezeman M., Zhang X., Lin P., Wang M., Qian J., Wan B., Kwak LW., Yu L., Yi Q. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Some interactions could not be curated as the antibodies used did not distiguish between FcgammaRII isoforms. Also it is not clear what cell type the CRP was expressed in. qyi@mdanderson.org 13-Nov-2007: Contacted by JYOTI. orchard Only protein-protein interactions 3 in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang J., Wezeman M., Zhang X., Lin P., Wang M., Qian J., Wan B., Kwak LW., Yu L., Yi Q. Apoptosis - Interactions involving proteins with a function related to apoptosis Some interactions could not be curated as the antibodies used did not distiguish between FcgammaRII isoforms. Also it is not clear what cell type the CRP was expressed in. qyi@mdanderson.org Accepted 2007-NOV-3 by ORCHARD. Cancer Cell (1535-6108) 2007 orchard Only protein-protein interactions 3 imex curation crp_human C-reactive protein CRP PTX1 protein protein human Homo sapiens Human MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP 669228636A8544F6 fcg2c_human Low affinity immunoglobulin gamma Fc region receptor II-c FCGR2C CD32 FCG2 IGFR2 Fc-gamma RII-c CDw32 protein protein human Homo sapiens Human MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN DC4C1A22A0DE4572 fcg2a_human Low affinity immunoglobulin gamma Fc region receptor II-a FCGR2A CD32 FCG2 FCGR2A1 IGFR2 Fc-gamma RII-a CDw32 protein protein human Homo sapiens Human MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN 07F73F3BB282DFF6 fcgr2a-crp 2 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait human-arp_1 Homo sapiens myeloma cell line ARP-1 arp_1 Human myeloma cell line ARP-1 physical association physical association 4 B immunoprecipitation using antibodies against either FcgRIIA, FcgRIIC, or CRP, but not IgG controls (data not shown) revealed that, on APR-1 cells that express both FcgRIIA and FcgRIIC, CRP was associated with both of these receptors fcgr2c-crp-1 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait human-arp_1 Homo sapiens myeloma cell line ARP-1 arp_1 Human myeloma cell line ARP-1 physical association physical association 4 B immunoprecipitation using antibodies against either FcgRIIA, FcgRIIC, or CRP, but not IgG controls (data not shown) revealed that, on APR-1 cells that express both FcgRIIA and FcgRIIC, CRP was associated with both of these receptors fcgr2c-crp-2 1 4 unspecified role unspecified role bait bait human-arp_1 Homo sapiens myeloma cell line ARP-1 arp_1 Human myeloma cell line ARP-1 3 unspecified role unspecified role prey prey physical association physical association 4 C On MM1-144 cells that express FcgRIIB and FcgRIIC,CRPwas predominantly associated with FcgRIIC but not FcgIIB