UniProt UniProt http://www.uniprot.org The autophagic inducer smARF interacts with and is stabilized by the mitochondrial p32 protein. The autophagic inducer smARF interacts with and is stabilized by the mitochondrial p32 protein. Oncogene (0950-9232) 2007 imex curation Reef S., Shifman O., Oren M., Kimchi A. Apoptosis - Interactions involving proteins with a function related to apoptosis adi.kimchi@weizmann.ac.il 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Reef S., Shifman O., Oren M., Kimchi A. Apoptosis - Interactions involving proteins with a function related to apoptosis adi.kimchi@weizmann.ac.il Accepted 2012-OCT-30 by PPORRAS 15-Nov-2012: Contacted by pporras. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation The autophagic inducer smARF interacts with and is stabilized by the mitochondrial p32 protein. The autophagic inducer smARF interacts with and is stabilized by the mitochondrial p32 protein. Oncogene (0950-9232) 2007 imex curation Reef S., Shifman O., Oren M., Kimchi A. Apoptosis - Interactions involving proteins with a function related to apoptosis adi.kimchi@weizmann.ac.il 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Reef S., Shifman O., Oren M., Kimchi A. Apoptosis - Interactions involving proteins with a function related to apoptosis adi.kimchi@weizmann.ac.il Accepted 2012-OCT-30 by PPORRAS 15-Nov-2012: Contacted by pporras. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation The autophagic inducer smARF interacts with and is stabilized by the mitochondrial p32 protein. The autophagic inducer smARF interacts with and is stabilized by the mitochondrial p32 protein. Oncogene (0950-9232) 2007 imex curation Reef S., Shifman O., Oren M., Kimchi A. Apoptosis - Interactions involving proteins with a function related to apoptosis adi.kimchi@weizmann.ac.il 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Reef S., Shifman O., Oren M., Kimchi A. Apoptosis - Interactions involving proteins with a function related to apoptosis adi.kimchi@weizmann.ac.il Accepted 2012-OCT-30 by PPORRAS 15-Nov-2012: Contacted by pporras. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation The autophagic inducer smARF interacts with and is stabilized by the mitochondrial p32 protein. The autophagic inducer smARF interacts with and is stabilized by the mitochondrial p32 protein. Oncogene (0950-9232) 2007 imex curation Reef S., Shifman O., Oren M., Kimchi A. Apoptosis - Interactions involving proteins with a function related to apoptosis adi.kimchi@weizmann.ac.il 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Reef S., Shifman O., Oren M., Kimchi A. Apoptosis - Interactions involving proteins with a function related to apoptosis adi.kimchi@weizmann.ac.il Accepted 2012-OCT-30 by PPORRAS 15-Nov-2012: Contacted by pporras. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation The autophagic inducer smARF interacts with and is stabilized by the mitochondrial p32 protein. The autophagic inducer smARF interacts with and is stabilized by the mitochondrial p32 protein. Oncogene (0950-9232) 2007 imex curation Reef S., Shifman O., Oren M., Kimchi A. Apoptosis - Interactions involving proteins with a function related to apoptosis adi.kimchi@weizmann.ac.il 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Reef S., Shifman O., Oren M., Kimchi A. Apoptosis - Interactions involving proteins with a function related to apoptosis adi.kimchi@weizmann.ac.il Accepted 2012-OCT-30 by PPORRAS 15-Nov-2012: Contacted by pporras. Oncogene (0950-9232) 2007 Only protein-protein interactions imex curation c1qbp_human Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP GC1QBP HABP1 SF2P32 Glycoprotein gC1qBP Hyaluronan-binding protein 1 Mitochondrial matrix protein p32 p33 ASF/SF2-associated protein p32 gC1q-R protein protein protein human Homo sapiens Human MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ DIP protein Q07021 original sequence version: 129 DIP protein Q07021 original sequence version: 156 2F747FA73BB1314B arf_mouse Tumor suppressor ARF Cdkn2a p19ARF Alternative reading frame Cyclin-dependent kinase inhibitor 2A protein protein mouse Mus musculus Mouse MGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILRRGPHRNPGPGDDDGQRSRSSSSAQLRCRFELRGPHYLLPPGARRSAGRLPGHAGGAARVRGSAGCARCLGSPAARLGPRAGTSRHRAIFAFRWVLFVFRWVVFVYRWERRPDRRA DIP protein Q64364 original sequence version: 97 DIP protein Q64364 original sequence version: 110 644505EFE1CBF478 arf_human Tumor suppressor ARF p14ARF CDKN2A CDKN2 MLM Alternative reading frame Cyclin-dependent kinase inhibitor 2A protein protein human Homo sapiens Human MVRRFLVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPSGGAAAAPRRGAQLRRPRHSHPTRARRCPGGLPGHAGGAAPGRGAAGRARCLGPSARGPG DIP protein Q8N726 original sequence version: 97 DIP protein Q8N726 original sequence version: 113 DIP protein Q8N726 original sequence version: 72 7739A9050C21BC96 cdkn2a-c1qbp 3 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1a cdkn2a-c1qbp-1 1 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association 1b cdkn2a-c1qbp-2 5 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association 1c and g c1qbp-cdkn2a 2 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait physical association physical association 1d cdkn2a-c1qbp-3 5 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey physical association physical association 1f and 2c c1qbp-cdkn2a-2 4 7 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 2a c1qbp-cdkn2a-3 4 8 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 2a