IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A fourth IkappaB protein within the NF-kappaB signaling module. A fourth IkappaB protein within the NF-kappaB signaling module. Cell (0092-8674) 2007 imex curation Basak S., Kim H., Kearns JD., Tergaonkar V., O'Dea E., Werner SL., Benedict CA., Ware CF., Ghosh G., Verma IM., Hoffmann A. Apoptosis - Interactions involving proteins with a function related to apoptosis Only protein-protein interactions 8 mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Basak S., Kim H., Kearns JD., Tergaonkar V., O'Dea E., Werner SL., Benedict CA., Ware CF., Ghosh G., Verma IM., Hoffmann A. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2007-APR-2 by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 8 imex curation A fourth IkappaB protein within the NF-kappaB signaling module. A fourth IkappaB protein within the NF-kappaB signaling module. Cell (0092-8674) 2007 imex curation Basak S., Kim H., Kearns JD., Tergaonkar V., O'Dea E., Werner SL., Benedict CA., Ware CF., Ghosh G., Verma IM., Hoffmann A. Apoptosis - Interactions involving proteins with a function related to apoptosis Only protein-protein interactions 8 mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. emsa supershift electrophoretic mobility supershift assay emsa supershift antibody detection identification by antibody antibody detection Basak S., Kim H., Kearns JD., Tergaonkar V., O'Dea E., Werner SL., Benedict CA., Ware CF., Ghosh G., Verma IM., Hoffmann A. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2007-APR-2 by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 8 imex curation A fourth IkappaB protein within the NF-kappaB signaling module. A fourth IkappaB protein within the NF-kappaB signaling module. Cell (0092-8674) 2007 imex curation Basak S., Kim H., Kearns JD., Tergaonkar V., O'Dea E., Werner SL., Benedict CA., Ware CF., Ghosh G., Verma IM., Hoffmann A. Apoptosis - Interactions involving proteins with a function related to apoptosis Only protein-protein interactions 8 mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. tap tandem affinity purification TAP TAP tap mudpit multidimensional protein identification technology mudpit Basak S., Kim H., Kearns JD., Tergaonkar V., O'Dea E., Werner SL., Benedict CA., Ware CF., Ghosh G., Verma IM., Hoffmann A. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell line (ikb-/-;rela-/-), TAP pulldown separated by gel electrophoresis followed by silver staining prior to protein identification by mass spectrometry Accepted 2007-APR-2 by JYOTI. Cell (0092-8674) 2007 Only protein-protein interactions 8 imex curation q9wtk5-pro_0000030 NF-kappaB2 p100 subunit - found in Q9WTK5 protein protein mouse Mus musculus Mouse An amino acid sequence which is not represented in UniProt tf65_mouse Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit Rela Nfkb3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein mouse Mus musculus Mouse MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINFDEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPAPVLTPGPPQSLSAPVPKSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS DIP protein Q04207 original sequence version: 158 DIP protein Q04207 original sequence version: 117 DIP protein Q04207-1 original sequence version: 117 DIP protein Q04207-1 original sequence version: 118 DIP protein Q04207 original sequence version: 119 DIP protein Q04207 original sequence version: 141 DIP protein Q04207-1 original sequence version: 141 DIP protein Q04207-1 original sequence version: 149 DIP protein Q04207 original sequence version: 149 DIP protein Q04207 original sequence version: 168 DIP protein Q04207 original sequence version: 125 BDF1673D2FE398B9 p25799-pro_0000030313 Nuclear factor NF-kappa-B p50 subunit Nfkb1 DNA-binding factor KBF1 EBP-1 NF-kappa-B1 p84/NF-kappa-B1 p98 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein mouse Mus musculus Mouse MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSNYGFPPYGGITFHPGVTKSNAGVTHG 0597F8EA07635A94 1 431 0597F8EA07635A94 kappab_containing kappaB containing probe, RelA and RelB binding (PMID: 17254973) dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid in vitro In vitro q9wtk5-pro_0000030324 Nuclear factor NF-kappa-B p52 subunit Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 Nfkb2 DNA-binding factor KBF2 protein protein mouse Mus musculus Mouse MDNCYDPGLDGIPEYDDFEFSPSIVEPKDPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGVCAVSVGPKDMTAQFNNLGVLHVTKKNMMEIMIQKLQRQRLRSKPQGLTEAERRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGSGGSAGGYGGAGGGGSLGFFSSSLAYNPYQSGAAPMGCYPGGGGGAQMAGSRRDTDAGEGAEEPRTPPEAPQGEPQALDTLQRAREYNARLFGLA 1 454 34E12C33A0CA8226 ikba_mouse NF-kappa-B inhibitor alpha I-kappa-B-alpha Nfkbia Ikba protein protein mouse Mus musculus Mouse MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAPLAAEPWKQQLTEDGDSFLHLAIIHEEKPLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVITNQPGIAEALLKAGCDPELRDFRGNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQATNYNGHTCLHLASIHGYLAIVEHLVTLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELPYDDCVFGGQRLTL DIP protein Q9Z1E3 original sequence version: 86 DIP protein Q9Z1E3 original sequence version: 127 DIP protein Q9Z1E3 original sequence version: 91 E1783F8E1BA93813 relb_mouse Transcription factor RelB Relb protein protein mouse Mus musculus Mouse MPSRRAARESAPELGALGSSDLSSLSLTVSRTTDELEIIDEYIKENGFGLDGTQLSEMPRLVPRGPASLSSVTLGPAAPPPPATPSWSCTLGRLVSPGPCPRPYLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGHLHRMDPILSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGLPDVLGELSSSDPHGIESKRRKKKPVFLDHFLPGHSSGLFLPPSALQPADSDFFPASISLPGLEPPGGPDLLDDGFAYDPSAPTLFTMLDLLPPAPPLASAVVGSGGAGATVVESSGPEPLSLDSFAAPGPGDVGTASLVGSNMFPNQYREAAFGGGLLSPGPEAT DIP protein Q04863 original sequence version: 82 AA49781A891ED7B8 nfkb2_mouse Nuclear factor NF-kappa-B p100 subunit Nfkb2 DNA-binding factor KBF2 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 protein protein mouse Mus musculus Mouse MDNCYDPGLDGIPEYDDFEFSPSIVEPKDPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGVCAVSVGPKDMTAQFNNLGVLHVTKKNMMEIMIQKLQRQRLRSKPQGLTEAERRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGSGGSAGGYGGAGGGGSLGFFSSSLAYNPYQSGAAPMGCYPGGGGGAQMAGSRRDTDAGEGAEEPRTPPEAPQGEPQALDTLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHLLMAQDENGDTPLHLAIIHGQTGVIEQIAHVIYHAQYLGVINLTNHLHQTPLHLAVITGQTRVVSFLLQVGADPTLLDRHGDSALHLALRAGAAAPELLQALLRSGAHAVPQILHMPDFEGLYPVHLAVHARSPECLDLLVDCGAEVEAPERQGGRTALHLATEMEELGLVTHLVTKLHANVNARTFAGNTPLHLAAGLGSPTLTRLLLKAGADIHAENEEPLCPLPSPSTSGSDSDSEGPERDTQRNFRGHTPLDLTCSTKVKTLLLNAAQNTTEPPLAPPSPAGPGLSLGDAALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRKTPSPSGSLLRSYKLAGGDLVGLLEALSDMGLHEGVRLLKGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLCPPPEPPGGLCHGHPQPQVH 3E98619F7D1C8AC7 p25799-pro_0000030312 Nuclear factor NF-kappa-B p105 subunit Nfkb1 DNA-binding factor KBF1 EBP-1 NF-kappa-B1 p84/NF-kappa-B1 p98 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein mouse Mus musculus Mouse MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSNYGFPPYGGITFHPGVTKSNAGVTHGTINTKFKNGPKDCAKSDDEESLTLPEKETEGEGPSLPMACTKTEPIALASTMEDKEQDMGFQDNLFLEKALQLARRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRVGADLSLLDRWGNSVLHLAAKEGHDRILSILLKSRKAAPLIDHPNGEGLNAIHIAVMSNSLPCLLLLVAAGAEVNAQEQKSGRTALHLAVEYDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWEKAGEDEGVVPGTTPLDMAANWQVFDILNGKPYEPVFTSDDILPQGDMKQLTEDTRLQLCKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTIKELMEALQQMGYTEAIEVIQAAFRTPATTASSPVTTAQVHCLPLSSSSTRQHIDELRDSDSVCDSGVETSFRKLSFTESLTGDSPLLSLNKMPHGYGQEGPIEGKI 1 971 91EA9C595E375C30 rela-nfkb1-1 2 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component association association Nuclear NF-B DNA binding activities (arrows and arrowhead) induced by 1 ng/ml of TNF, 10 g/ml or 0.3 g/ml of LT R agonistic antibody were resolved by EMSA with a B-site containing probe. 1C, 2G, S2C Anti-lymphotoxin beta receptor relb-nfkb2-2 2 8 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component association association Nuclear NF-B DNA binding activities (arrows and arrowhead) induced by 1 ng/ml of TNF, 10 g/ml or 0.3 g/ml of LTR agonistic antibody were resolved by EMSA with a B-site containing probe. 1C Anti-lymphotoxin beta receptor rela-nfkb1-2 3 6 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association LC-MS/MS analysis revealed that indicated gel slices contained p100, p65, and p50 proteins respectively. 2B rela-nfkb1-3 1 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association Immunoblots of RelA coimmunoprecipitates prepared from wild-type (left panel) or I B / /var epsilon-deficient (right panel) MEF lysates revealed RelA association with I B , p50, p100, and p105 proteins. 2C, 3D Experiments in Nfkbia deficient cells showed this protein to be inessential for complex formation The composition of this complex appears to alter in response to detergent-stripping of the p100 component following treatment of the cells with Lympotoxin beta receptor (fig 3D) rela-nfkb1-4 1 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association The fractions of cellular p100 or p105 bound to RelA or RelB were examined by immunoblots of RelA or RelB immunoprecipitate (IP) 2D relb-nfkb1-1 1 4 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association The fractions of cellular p100 or p105 bound to RelA or RelB were examined by immunoblots of RelA or RelB immunoprecipitate (IP) 2D rela-nfkb1-5 1 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait association association Immunoblots of RelA coimmunoprecipitates prepared from wild-type (left panel) or I B / /var epsilon-deficient (right panel) MEF lysates revealed RelA association with I B , p50, p100, and p105 proteins. 3A Anti-lymphotoxin-beta receptor nfkb1-nfkb2-1 1 4 unspecified role unspecified role bait bait c-terminal region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association Increased p52 association with p100 following LT R signaling. 3G Anti-lymphotoxin beta receptor Author stated length of Nfkb2 (934aa) is longer than that currently given in UniProt. rela-nfkb2-1 1 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association RelA protein associated with p105 and p100 were examined by RelA immunoblotting of immunoprecipitates from wild type (left panel) or I B-deficient (right panel) S2A Interaction shown not to depend on presence of I-kappaB alpha rela-nfkb1-6 1 5 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association RelA protein associated with p105 and p100 were examined by RelA immunoblotting of immunoprecipitates from wild type (left panel) or I B deficient (right panel) S2B