IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mechanisms of apoptosis sensitivity and resistance to the BH3 mimetic ABT-737 in acute myeloid leukemia. Mechanisms of apoptosis sensitivity and resistance to the BH3 mimetic ABT-737 in acute myeloid leukemia. Cancer Cell (1535-6108) 2006 imex curation Konopleva M., Contractor R., Tsao T., Samudio I., Ruvolo PP., Kitada S., Deng X., Zhai D., Shi YX., Sneed T., Verhaegen M., Soengas M., Ruvolo VR., McQueen T., Schober WD., Watt JC., Jiffar T., Ling X., Marini FC., Harris D., Dietrich M., Estrov Z., McCubrey J., May WS., Reed JC., Andreeff M. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Other Bcl-2 family proteins in assays have isoforms and the assays do not distinguish between the isoforms. The species of the MBP in the ERK assay is not clear. Therefore these interactions could not be curated. mandreef@mdanderson.org 21-Dec-2006: Contacted by JYOTI. Only protein-protein interactions 1 human-oci_aml3 Homo sapiens OCI-AML3 oci_aml3 OCI-AML3 Established from the peripheral blood of a 57-year-old man with acute myeloid leukemia; cells carry an NPM gene mutation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Konopleva M., Contractor R., Tsao T., Samudio I., Ruvolo PP., Kitada S., Deng X., Zhai D., Shi YX., Sneed T., Verhaegen M., Soengas M., Ruvolo VR., McQueen T., Schober WD., Watt JC., Jiffar T., Ling X., Marini FC., Harris D., Dietrich M., Estrov Z., McCubrey J., May WS., Reed JC., Andreeff M. Apoptosis - Interactions involving proteins with a function related to apoptosis Other Bcl-2 family proteins in assays have isoforms and the assays do not distinguish between the isoforms. The species of the MBP in the ERK assay is not clear. Therefore these interactions could not be curated. mandreef@mdanderson.org Accepted 2006-DEC-8 by DAVET. 21-Dec-2006: Contacted by JYOTI. Cancer Cell (1535-6108) 2006 Only protein-protein interactions 1 imex curation bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS DIP protein Q16611 original sequence version: 74 DIP protein Q16611 original sequence version: 162 DIP protein Q16611 original sequence version: 97 DIP protein Q16611 original sequence version: 158 DIP protein Q16611 original sequence version: 151 DIP protein Q16611-1 original sequence version: 178 DIP protein Q16611-1 original sequence version: 180 DIP protein Q16611 original sequence version: 121 A2200FE72A46D04E mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein Q07820 original sequence version: 85 DIP protein Q07820 original sequence version: 89 DIP protein Q07820 original sequence version: 113 DIP protein Q07820 original sequence version: 168 DIP protein Q07820-1 original sequence version: 113 D85821AC59275F1F bak1-mcl1 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association 4 B when BIM or BAK was immunoprecipitated from OCI-AML3 cells, coimmunoprecipitation of MCL-1 was unimpaired in ABT-737-treated cells. ABT-737 treatment did not affect the amount of MCcl-1 coiimunoprecipitated with Bak. In ABT-737-sensitive HL-60 cells, no detectable MCL-1 was found in complex with Bak.