IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Keratin 17 modulates hair follicle cycling in a TNFalpha-dependent fashion. Keratin 17 modulates hair follicle cycling in a TNFalpha-dependent fashion. Genes Dev. (0890-9369) 2006 imex curation Tong X., Coulombe PA. Apoptosis - Interactions involving proteins with a function related to apoptosis coulombe@jhmi.edu 13-Nov-2007: Contacted by JYOTI. davet Only protein-protein interactions mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tong X., Coulombe PA. Apoptosis - Interactions involving proteins with a function related to apoptosis coulombe@jhmi.edu Accepted 2007-NOV-24 by DAVET. Genes Dev. (0890-9369) 2006 davet Only protein-protein interactions imex curation Keratin 17 modulates hair follicle cycling in a TNFalpha-dependent fashion. Keratin 17 modulates hair follicle cycling in a TNFalpha-dependent fashion. Genes Dev. (0890-9369) 2006 imex curation Tong X., Coulombe PA. Apoptosis - Interactions involving proteins with a function related to apoptosis coulombe@jhmi.edu 13-Nov-2007: Contacted by JYOTI. davet Only protein-protein interactions mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Tong X., Coulombe PA. Apoptosis - Interactions involving proteins with a function related to apoptosis coulombe@jhmi.edu Accepted 2007-NOV-24 by DAVET. 13-Nov-2007: Contacted by JYOTI. Genes Dev. (0890-9369) 2006 davet Only protein-protein interactions imex curation k1c14_mouse Keratin, type I cytoskeletal 14 Krt14 Krt1-14 Cytokeratin-14 Keratin-14 protein protein mouse Mus musculus Mouse MATCSRQFTSSSSMKGSCGIGGGSSRMSSILAGGSCRAPSTYGGMSVTSSRFSSGGACGIGGGYGGSFSSSSFGGGLGSGFGGRFDGFGGGFGGGLGGGFGGGLGGGLGGGIGDGLLVGSEKVTMQNLNDRLATYLDKVRALEEANTELEVKIRDWYQRQRPTEIKDYSPYFKTIEDLKSKILAATVDNANVLLQIDNARLAADDFRTKFETEQSLRMSVEADINGLRRVLDELTLARADLEMQIESLKEELAYLKKNHEEEMASMRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFSKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENNLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSSSQFSSGSQSSRDVTSTNRQIRTKVMDVHDGKVVSTHEQVLRTKN A9B6BA66B2F46668 k1c16_mouse Keratin, type I cytoskeletal 16 Krt16 Krt1-16 Cytokeratin-16 Keratin-16 protein protein mouse Mus musculus Mouse MATCSRQFTSSSSMKGSCGIGGGSSRMSSILAGGSCRAPSTCGGMSVTSSRFSSGGVCGIGGGYGGSFSSSSFGGGLGSGFGGRFDGFGGGFGAGLGGGLGGGIGDGLLVGSEKVTMQNLNDRLATYLDKVRALEEANRDLEVKIRDWYQRQRPTEIKDYSPYFKTIEDLKSKIIIATQENAQFTLQIDNARLAADDFRTKYENELFLRQSVEGDINGLRKVLDELTLSRADLEMQIENLREELAFLKKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKNRRDVEAWFLRKTEELNKEVASNSDLIQSNRSEVAELRRVFQGLEIELQSQLSMKASLENSLEETKGRYCMQLSQIQGLISSVEEQLAQLRCEMEQQSQEYNILLDVKTRLEQEIATYRRLLDGENIHSSSQHSSGQSYSSREVFSSSSRQPRSILKEQGSTSFSQSQSQSSRD 13B8028CF28B64D5 k1c17_mouse Keratin, type I cytoskeletal 17 Krt17 Krt1-17 Keratin-17 Cytokeratin-17 protein protein mouse Mus musculus Mouse MTTTIRQFTSSSSIKGSSGLGGGSSRTSCRLSGSLGAGSCRLGSASGLGSALGSNSYSSCYSFGTGSGYGGNFGGVDGLLAGGEKATMQNLNDRLASYLDKVRALEEANTELEVKIRDWYQKQAPGPARDYSAYYHTIEDLKNKILVATVDNASILLQIDNARLAADDFRTKFETEQALRMSVEADINGLRRVLDELTLARADLEMQIENLKEELAYLKKNHEEEMNALRGQVGGEINVEMDAAPGVDLSRILSEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEISELRRTMQALEIELQSQLSMKASLEGSLAETENRYCVQLSQIQGLIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKPKEPVTTRQVRTIVEEVQDGKVISSREQVHQTTR DIP protein Q9QWL7 original sequence version: 106 279081DF2ECE105D tradd_mouse Tumor necrosis factor receptor type 1-associated DEATH domain protein Tradd TNFRSF1A-associated via death domain protein protein mouse Mus musculus Mouse MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRAGAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGSKFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCRALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLLGQAEPDGGLA DIP protein Q3U0V2 original sequence version: 33 DIP protein Q3U0V2 original sequence version: 26 DIP protein Q3U0V2 original sequence version: 90 225F00D4022691BB krt17-tradd 1 5 unspecified role unspecified role prey prey mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] 6 unspecified role unspecified role bait bait mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] physical association physical association Figure 3A,A' Coimmunoprecipitation assays using two distinct antibodies revealed that, as expected, K17, K16, and K14 are present in endogenous TRADD immunopreciptates obtained from primary cultures of mouse skin keratinocytes (Fig. 3A,A'). Krt17 associates with endogenous TRADD. krt16-tradd 1 4 unspecified role unspecified role prey prey mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] 6 unspecified role unspecified role bait bait mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] physical association physical association Figure 3A,A' Coimmunoprecipitation assays using two distinct antibodies revealed that, as expected, K17, K16, and K14 are present in endogenous TRADD immunopreciptates obtained from primary cultures of mouse skin keratinocytes (Fig. 3A,A'). Krt16 associates with endogenous TRADD. krt14-tradd 1 3 unspecified role unspecified role prey prey mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] 6 unspecified role unspecified role bait bait mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] physical association physical association Figure 3A,A' Coimmunoprecipitation assays using two distinct antibodies revealed that, as expected, K17, K16, and K14 are present in endogenous TRADD immunopreciptates obtained from primary cultures of mouse skin keratinocytes (Fig. 3A,A'). Krt14 associates with endogenous TRADD. krt17-tradd-1 2 6 unspecified role unspecified role bait bait region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1544102]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 312-312, sequence length 310 [EBI-1544102]105-312 mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] 5 unspecified role unspecified role prey prey mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] physical association physical association Figure 3B-B", 3C-C". In mouse keratinocytes transfected with GFP fusion constructs, both full-length TRADD (residues 1-312)(Fig. 3B-B") and its C-terminal moiety (residues 105-312)(Fig. 3C-C") partially colocalize with K17 in the cytoplasm. It was observed that both full-length TRADD (AA 1-312) and its C-terminal moiety (AA 105-312) partially colocalize with K17 in the cytoplasm. In contrast, the N-terminus of TRADD (AA 1-105) showed a diffuse distribution in the cytoplasm and nucleus.