IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction of Pin1 with Nek6 and characterization of their expression correlation in Chinese hepatocellular carcinoma patients. Interaction of Pin1 with Nek6 and characterization of their expression correlation in Chinese hepatocellular carcinoma patients. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Chen J., Li L., Zhang Y., Yang H., Wei Y., Zhang L., Liu X., Yu L. Apoptosis - Interactions involving proteins with a function related to apoptosis longyu@fudan.edu.cn 27-NOV-2006: Contacted by JYOTI. Only protein-protein interactions human-hep_3b Homo sapiens hepatocellular carcinoma (HCC) cells (p53-null). hep_3b human hepatocellular carcinoma (HCC) cells (p53-null). anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chen J., Li L., Zhang Y., Yang H., Wei Y., Zhang L., Liu X., Yu L. Apoptosis - Interactions involving proteins with a function related to apoptosis longyu@fudan.edu.cn Accepted 2006-NOV-15 by JYOTI. 27-NOV-2006: Contacted by JYOTI. Biochem. Biophys. Res. Commun. (0006-291X) 2006 Only protein-protein interactions imex curation Interaction of Pin1 with Nek6 and characterization of their expression correlation in Chinese hepatocellular carcinoma patients. Interaction of Pin1 with Nek6 and characterization of their expression correlation in Chinese hepatocellular carcinoma patients. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Chen J., Li L., Zhang Y., Yang H., Wei Y., Zhang L., Liu X., Yu L. Apoptosis - Interactions involving proteins with a function related to apoptosis longyu@fudan.edu.cn 27-NOV-2006: Contacted by JYOTI. Only protein-protein interactions human-hep_3b Homo sapiens hepatocellular carcinoma (HCC) cells (p53-null). hep_3b human hepatocellular carcinoma (HCC) cells (p53-null). fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Chen J., Li L., Zhang Y., Yang H., Wei Y., Zhang L., Liu X., Yu L. Apoptosis - Interactions involving proteins with a function related to apoptosis longyu@fudan.edu.cn Accepted 2006-NOV-15 by JYOTI. 27-NOV-2006: Contacted by JYOTI. Biochem. Biophys. Res. Commun. (0006-291X) 2006 Only protein-protein interactions imex curation Interaction of Pin1 with Nek6 and characterization of their expression correlation in Chinese hepatocellular carcinoma patients. Interaction of Pin1 with Nek6 and characterization of their expression correlation in Chinese hepatocellular carcinoma patients. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Chen J., Li L., Zhang Y., Yang H., Wei Y., Zhang L., Liu X., Yu L. Apoptosis - Interactions involving proteins with a function related to apoptosis longyu@fudan.edu.cn 27-NOV-2006: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Chen J., Li L., Zhang Y., Yang H., Wei Y., Zhang L., Liu X., Yu L. Apoptosis - Interactions involving proteins with a function related to apoptosis longyu@fudan.edu.cn Accepted 2006-NOV-15 by JYOTI. 27-NOV-2006: Contacted by JYOTI. Biochem. Biophys. Res. Commun. (0006-291X) 2006 Only protein-protein interactions imex curation nek6_human Serine/threonine-protein kinase Nek6 Never in mitosis A-related kinase 6 Protein kinase SID6-1512 NEK6 protein protein human Homo sapiens Human MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST B898DC57407A8C16 pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE DIP protein Q13526 original sequence version: 65 DIP protein Q13526 original sequence version: 64 DIP protein Q13526 original sequence version: 163 DIP protein Q13526 original sequence version: 156 DIP protein Q13526 original sequence version: 117 35391AF40B7D1E13 pin1-nek6-1 3 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region (possible) phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hep_3b Homo sapiens hepatocellular carcinoma (HCC) cells (p53-null). hep_3b human hepatocellular carcinoma (HCC) cells (p53-null). physical association physical association 1B Using a GST-Pin1 fusion protein, in vitro GST pulldown assays were performed. Results showed that Myc- Nek6 protein associated with the GST-Pin1 fusion protein (Fig. 1B, lane 3) pin1-nek6-2 1 5 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2 When Myc-Nek6 was immunoprecipitated, Flag-Pin1 was co-precipitated with Nek6 (Fig. 2B, lane 6 ) blotted with anti-Flag mAb. pin1-nek6-3 2 5 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 3 Colocalization of Pin1 and Nek6 in Hep 3B cells