IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ RIN1 is an ABL tyrosine kinase activator and a regulator of epithelial-cell adhesion and migration. RIN1 is an ABL tyrosine kinase activator and a regulator of epithelial-cell adhesion and migration. Curr. Biol. (0960-9822) 2005 imex curation Hu H., Bliss JM., Wang Y., Colicelli J. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of Abl2 taken from previous work by gifting laboratory and mapping of mutants. Origin of Rin1 taken from mapping of mutants. Origin of h-ras taken from previous work of the author and mutant mapping. collicelli@mednet.ucla.edu 30-OCT-2006: Contacted by JYOTI. Returned mail. Only protein-protein interactions human-mcf10a Human non-transformed breast epithelial cell line mcf10a non-transformed human breast epithelial cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hu H., Bliss JM., Wang Y., Colicelli J. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of Abl2 taken from previous work by gifting laboratory and mapping of mutants. Origin of Rin1 taken from mapping of mutants. Origin of h-ras taken from previous work of the author and mutant mapping. collicelli@mednet.ucla.edu Accepted 2006-OCT-5 by DAVET. 30-OCT-2006: Contacted by JYOTI. Returned mail. Curr. Biol. (0960-9822) 2005 Only protein-protein interactions imex curation RIN1 is an ABL tyrosine kinase activator and a regulator of epithelial-cell adhesion and migration. RIN1 is an ABL tyrosine kinase activator and a regulator of epithelial-cell adhesion and migration. Curr. Biol. (0960-9822) 2005 imex curation Hu H., Bliss JM., Wang Y., Colicelli J. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of Abl2 taken from previous work by gifting laboratory and mapping of mutants. Origin of Rin1 taken from mapping of mutants. Origin of h-ras taken from previous work of the author and mutant mapping. collicelli@mednet.ucla.edu 30-OCT-2006: Contacted by JYOTI. Returned mail. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hu H., Bliss JM., Wang Y., Colicelli J. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of Abl2 taken from previous work by gifting laboratory and mapping of mutants. Origin of Rin1 taken from mapping of mutants. Origin of h-ras taken from previous work of the author and mutant mapping. collicelli@mednet.ucla.edu Accepted 2006-OCT-5 by DAVET. 30-OCT-2006: Contacted by JYOTI. Returned mail. Curr. Biol. (0960-9822) 2005 Only protein-protein interactions imex curation RIN1 is an ABL tyrosine kinase activator and a regulator of epithelial-cell adhesion and migration. RIN1 is an ABL tyrosine kinase activator and a regulator of epithelial-cell adhesion and migration. Curr. Biol. (0960-9822) 2005 imex curation Hu H., Bliss JM., Wang Y., Colicelli J. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of Abl2 taken from previous work by gifting laboratory and mapping of mutants. Origin of Rin1 taken from mapping of mutants. Origin of h-ras taken from previous work of the author and mutant mapping. collicelli@mednet.ucla.edu 30-OCT-2006: Contacted by JYOTI. Returned mail. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Hu H., Bliss JM., Wang Y., Colicelli J. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of Abl2 taken from previous work by gifting laboratory and mapping of mutants. Origin of Rin1 taken from mapping of mutants. Origin of h-ras taken from previous work of the author and mutant mapping. collicelli@mednet.ucla.edu Accepted 2006-OCT-5 by DAVET. 30-OCT-2006: Contacted by JYOTI. Returned mail. Curr. Biol. (0960-9822) 2005 Only protein-protein interactions imex curation RIN1 is an ABL tyrosine kinase activator and a regulator of epithelial-cell adhesion and migration. RIN1 is an ABL tyrosine kinase activator and a regulator of epithelial-cell adhesion and migration. Curr. Biol. (0960-9822) 2005 imex curation Hu H., Bliss JM., Wang Y., Colicelli J. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of Abl2 taken from previous work by gifting laboratory and mapping of mutants. Origin of Rin1 taken from mapping of mutants. Origin of h-ras taken from previous work of the author and mutant mapping. collicelli@mednet.ucla.edu 30-OCT-2006: Contacted by JYOTI. Returned mail. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hu H., Bliss JM., Wang Y., Colicelli J. Apoptosis - Interactions involving proteins with a function related to apoptosis Identity of Abl2 taken from previous work by gifting laboratory and mapping of mutants. Origin of Rin1 taken from mapping of mutants. Origin of h-ras taken from previous work of the author and mutant mapping. collicelli@mednet.ucla.edu Accepted 2006-OCT-5 by DAVET. 30-OCT-2006: Contacted by JYOTI. Returned mail. Curr. Biol. (0960-9822) 2005 Only protein-protein interactions imex curation abl1_human Tyrosine-protein kinase ABL1 Abelson tyrosine-protein kinase 1 ABL1 ABL JTK7 Abelson murine leukemia viral oncogene homolog 1 Proto-oncogene c-Abl p150 protein protein human Homo sapiens Human MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEHRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPPPPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR DIP protein P00519 original sequence version: 114 DIP protein P00519 original sequence version: 137 DIP protein P00519 original sequence version: 161 DIP protein P00519 original sequence version: 220 DIP protein P00519 original sequence version: 219 85FE6C1C0E483EA2 crk_chick Adapter molecule crk CRK p38 Proto-oncogene c-Crk protein protein chick Gallus gallus (Chicken) Chicken MAGQFDSEDRGSWYWGRLSRGDAVSLLQGQRHGTFLVRDSGSIPGDFVLSVSESSRVSHYIVNSLGPAGGRRAGGEGPGAPGLNPTRFRIGDQEFDSLPSLLEFYKIHYLDTTTLIEPVSRSRQNSGVILRQEEVEYVRALFDFNGNDDEDLPFKKGDILKIRDKPEEQWWNAEDMDGKRGMIPVPYVEKCRPSSASVSTLTGGNQDSSHPQPLGGPEPGPYAQPSINTPLPNLQNGPFYARVIQKRVPNAYDKTALALEVGELVKVTKINMSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS 0A79AD232E824768 rash_human GTPase HRas HRAS HRAS1 Transforming protein p21 p21ras H-Ras-1 c-H-ras Ha-Ras protein protein human Homo sapiens Human MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS DIP protein P01112 original sequence version: 91 DIP protein P01112 original sequence version: 106 DIP protein P01112 original sequence version: 144 DIP protein P01112 original sequence version: 118 DIP protein P01112 original sequence version: 143 DIP protein P01112 original sequence version: 152 DIP protein P01112-1 original sequence version: 159 DIP protein P01112 original sequence version: 170 DIP protein P01112-1 original sequence version: 185 DIP protein P01112 original sequence version: 192 DIP protein P01112-1 original sequence version: 196 DIP protein P01112-1 original sequence version: 202 EE6DC2D933E2856A abl2_human Tyrosine-protein kinase ABL2 Abelson tyrosine-protein kinase 2 ABL2 ABLL ARG Abelson murine leukemia viral oncogene homolog 2 Abelson-related gene protein Tyrosine-protein kinase ARG protein protein human Homo sapiens Human MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTTETGFNIFTQHDHFASCVEDGFEGDKTGGSSPEALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTADGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADGFSFTPAQQEANLVPPKCYGGSFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGATALPLRTPSGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLGMAGVPEDGEQPGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQEGGKKAALGAVPISGKAGRPVMPPPQVPLPTSSISPAKMANGTAGTKVALRKTKQAAEKISADKISKEALLECADLLSSALTEPVPNSQLVDTGHQLLDYCSGYVDCIPQTRNKFAFREAVSKLELSLQELQVSSAAAGVPGTNPVLNNLLSCVQEISDVVQR ED93869BC2B14FAA ED93869BC2B14FAA crk_human Adapter molecule crk Proto-oncogene c-Crk CRK p38 protein protein human Homo sapiens Human MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPDEDFS 4CFBFB65BFC2E265 rin1_human Ras and Rab interactor 1 RIN1 Ras interaction/interference protein 1 Ras inhibitor JC99 protein protein human Homo sapiens Human MESPGESGAGSPGAPSPSSFTTGHLAREKPAQDPLYDVPNASGGQAGGPQRPGRVVSLRERLLLTRPVWLQLQANAAAALHMLRTEPPGTFLVRKSNTRQCQALCMRLPEASGPSFVSSHYILESPGGVSLEGSELMFPDLVQLICAYCHTRDILLLPLQLPRAIHHAATHKELEAISHLGIEFWSSSLNIKAQRGPAGGPVLPQLKARSPQELDQGTGAALCFFNPLFPGDLGPTKREKFKRSFKVRVSTETSSPLSPPAVPPPPVPVLPGAVPSQTERLPPCQLLRRESSVGYRVPAGSGPSLPPMPSLQEVDCGSPSSSEEEGVPGSRGSPATSPHLGRRRPLLRSMSAAFCSLLAPERQVGRAAAALMQDRHTAAGQLVQDLLTQVRAGPEPQELQGIRQALSRARAMLSAELGPEKLLSPKRLEHVLEKSLHCSVLKPLRPILAARLRRRLAADGSLGRLAEGLRLARAQGPGAFGSHLSLPSPVELEQVRQKLLQLLRTYSPSAQVKRLLQACKLLYMALRTQEGEGAGADEFLPLLSLVLAHCDLPELLLEAEYMSELLEPSLLTGEGGYYLTSLSASLALLSGLGQAHTLPLSPVQELRRSLSLWEQRRLPATHCFQHLLRVAYQDPSSGCTSKTLAVPPEASIATLNQLCATKFRVTQPNTFGLFLYKEQGYHRLPPGALAHRLPTTGYLVYRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETTAEGGQGQAQEGPAQPGEPEAEGSRAAEE 2B4DA70147CDDDFE abl2-rin1-1 2 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P42684:p.Lys317Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Wed May 02 16:41:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys317arg' Tue Jun 30 16:58:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys317Arg' 10 unspecified role unspecified role prey prey physical association physical association P42684 transfection; Q13671 transfection 2A, 2C Anti-Flag (ABL2)-immunoprecipitated material was immunobloted with anti-RIN1 (left), and anti-RIN1-immunoprecipitated material was immunobloted with anti-Flag (right). Lys-317 is decribed as lys-319 in the text but as 317 in the methods and Materials. 317 maps to the UniProtKB record. abl2-rin1-2 4 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait physical association physical association P42684 transfection; Q13671 transfection 2A Anti-Flag (ABL2)-immunoprecipitated material was immunobloted with anti-RIN1 (left), and anti-RIN1-immunoprecipitated material was immunobloted with anti-Flag (right). abl1-rin1-1 4 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Q13671 transfection; P00519 transfection; 2B RIN1 binding to ABL1 was assessed with anti-RIN1 or anti-ABL1 immunoprecipitation from extracts of transfected 293 cells. abl1-rin1-2 4 5 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Q13671 transfection; P00519 transfection; 2B RIN1 binding to ABL1 was assessed with anti-RIN1 or anti-ABL1 immunoprecipitation from extracts of transfected 293 cells. abl1-rin1-3 1 5 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 2B The right side shows immunoprecipitation of endogenous RIN1 with endogenous ABL1 from MCF10A cells when anti-ABL1 but not anti-Flag (control) was used abl2-rin1-3 2 10 unspecified role unspecified role prey prey Q13671:p.[Tyr36Phe;Tyr121Phe;Tyr148Phe] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F Wed May 02 16:55:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr36phe,tyr121phe,tyr148phe' Tue Jun 30 19:38:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr36Phe;Tyr121Phe;Tyr148Phe]' abl binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association P42684 transfection; Q13671 unclear 2A, 2D RIN1 tyrosine phosphorylation is required for ABL2 binding. RIN1-ABD and an SH2 mutant (RIN1-ABDR94N), but not a triple-tyrosine mutant (RIN1-ABDTM) abl2-crk-1 3 6 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 8 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. phosphorylation phosphorylation reaction phosphorylation Phosphorylation of Tyr-222 of Q04929 5B Kinase assays with purified His6-ABL2 (1.5 nM), GST-CRK or GST-CRKY222F (chicken) (17 nM), and RIN1-ABD-His6 (5 nM or 10 nM). Rin1 (1-295). Effects are time and concentration dependent. abl2-crk-2 3 8 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. 9 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. phosphorylation phosphorylation reaction phosphorylation Phosphorylation of Tyr-221 of p46108 5C Kinase assays with purified His6-ABL2 (1 nM), His6-CRKII (human) (1 μM), and RIN1-ABD-His6 (� STI571 [10 μM]). Rin1 (1-295). Effects are time and concentration dependent. STI571 (10uM). abl2-rin1-4 2 7 unspecified role unspecified role prey prey P01112:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 20:18:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 19:53:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey association association P42684 transfection; Q13671 transfection; P01112 transfection 6A Expression of HRASG12V (activated RAS), RIN1, and ABL2 resulted in the formation of a complex including all three proteins, as detected by immunoprecipitation of either ABL2 or HRAS (Figure 6A). abl2-rin1-5 4 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait P01112:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 17:17:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 19:48:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association P42684 transfection; Q13671 transfection; P01112 transfection 6A Expression of HRASG12V (activated RAS), RIN1, and ABL2 resulted in the formation of a complex including all three proteins, as detected by immunoprecipitation of either ABL2 or HRAS (Figure 6A).