IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ COMMD proteins, a novel family of structural and functional homologs of MURR1. COMMD proteins, a novel family of structural and functional homologs of MURR1. J. Biol. Chem. (0021-9258) 2005 Burstein E., Hoberg JE., Wilkinson AS., Rumble JM., Csomos RA., Komarck CM., Maine GN., Wilkinson JC., Mayo MW., Duckett CS. Apoptosis - Interactions involving proteins with a function related to apoptosis MURR1-TAP was subsequently purified from cells lysates using two sequential chromatography columns containing IgG and calmodulin beads. The material obtained was subjected to tryptic digestion, and the peptides generated were then identified by tandem mass spectrometry (MS/MS) after initial separation using liquid chromatography. The origins of MURR1 determined based ont he back references provided in the publication; PMID: 14685266. colind@umich.edu 2007-10-15: W.H. Ouwehand, Department of Haematology, University of Cambridge davet human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down western blot western blot Immuno blot Immuno blot Burstein E., Hoberg JE., Wilkinson AS., Rumble JM., Csomos RA., Komarck CM., Maine GN., Wilkinson JC., Mayo MW., Duckett CS. Apoptosis - Interactions involving proteins with a function related to apoptosis MURR1-TAP was subsequently purified from cells lysates using two sequential chromatography columns containing IgG and calmodulin beads. The material obtained was subjected to tryptic digestion, and the peptides generated were then identified by tandem mass spectrometry (MS/MS) after initial separation using liquid chromatography. The origins of MURR1 determined based ont he back references provided in the publication; PMID: 14685266. colind@umich.edu Accepted 2007-DEC-15 by DAVET. 2007-10-15: W.H. Ouwehand, Department of Haematology, University of Cambridge J. Biol. Chem. (0021-9258) 2005 davet COMMD proteins, a novel family of structural and functional homologs of MURR1. COMMD proteins, a novel family of structural and functional homologs of MURR1. J. Biol. Chem. (0021-9258) 2005 Burstein E., Hoberg JE., Wilkinson AS., Rumble JM., Csomos RA., Komarck CM., Maine GN., Wilkinson JC., Mayo MW., Duckett CS. Apoptosis - Interactions involving proteins with a function related to apoptosis MURR1-TAP was subsequently purified from cells lysates using two sequential chromatography columns containing IgG and calmodulin beads. The material obtained was subjected to tryptic digestion, and the peptides generated were then identified by tandem mass spectrometry (MS/MS) after initial separation using liquid chromatography. The origins of MURR1 determined based ont he back references provided in the publication; PMID: 14685266. colind@umich.edu 2007-10-15: W.H. Ouwehand, Department of Haematology, University of Cambridge davet human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Burstein E., Hoberg JE., Wilkinson AS., Rumble JM., Csomos RA., Komarck CM., Maine GN., Wilkinson JC., Mayo MW., Duckett CS. Apoptosis - Interactions involving proteins with a function related to apoptosis MURR1-TAP was subsequently purified from cells lysates using two sequential chromatography columns containing IgG and calmodulin beads. The material obtained was subjected to tryptic digestion, and the peptides generated were then identified by tandem mass spectrometry (MS/MS) after initial separation using liquid chromatography. The origins of MURR1 determined based ont he back references provided in the publication; PMID: 14685266. colind@umich.edu Accepted 2007-DEC-15 by DAVET. 2007-10-15: W.H. Ouwehand, Department of Haematology, University of Cambridge J. Biol. Chem. (0021-9258) 2005 davet COMMD proteins, a novel family of structural and functional homologs of MURR1. COMMD proteins, a novel family of structural and functional homologs of MURR1. J. Biol. Chem. (0021-9258) 2005 Burstein E., Hoberg JE., Wilkinson AS., Rumble JM., Csomos RA., Komarck CM., Maine GN., Wilkinson JC., Mayo MW., Duckett CS. Apoptosis - Interactions involving proteins with a function related to apoptosis MURR1-TAP was subsequently purified from cells lysates using two sequential chromatography columns containing IgG and calmodulin beads. The material obtained was subjected to tryptic digestion, and the peptides generated were then identified by tandem mass spectrometry (MS/MS) after initial separation using liquid chromatography. The origins of MURR1 determined based ont he back references provided in the publication; PMID: 14685266. colind@umich.edu 2007-10-15: W.H. Ouwehand, Department of Haematology, University of Cambridge davet human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western Burstein E., Hoberg JE., Wilkinson AS., Rumble JM., Csomos RA., Komarck CM., Maine GN., Wilkinson JC., Mayo MW., Duckett CS. Apoptosis - Interactions involving proteins with a function related to apoptosis MURR1-TAP was subsequently purified from cells lysates using two sequential chromatography columns containing IgG and calmodulin beads. The material obtained was subjected to tryptic digestion, and the peptides generated were then identified by tandem mass spectrometry (MS/MS) after initial separation using liquid chromatography. The origins of MURR1 determined based ont he back references provided in the publication; PMID: 14685266. colind@umich.edu Accepted 2007-DEC-15 by DAVET. 2007-10-15: W.H. Ouwehand, Department of Haematology, University of Cambridge J. Biol. Chem. (0021-9258) 2005 davet COMMD proteins, a novel family of structural and functional homologs of MURR1. COMMD proteins, a novel family of structural and functional homologs of MURR1. J. Biol. Chem. (0021-9258) 2005 Burstein E., Hoberg JE., Wilkinson AS., Rumble JM., Csomos RA., Komarck CM., Maine GN., Wilkinson JC., Mayo MW., Duckett CS. Apoptosis - Interactions involving proteins with a function related to apoptosis MURR1-TAP was subsequently purified from cells lysates using two sequential chromatography columns containing IgG and calmodulin beads. The material obtained was subjected to tryptic digestion, and the peptides generated were then identified by tandem mass spectrometry (MS/MS) after initial separation using liquid chromatography. The origins of MURR1 determined based ont he back references provided in the publication; PMID: 14685266. colind@umich.edu 2007-10-15: W.H. Ouwehand, Department of Haematology, University of Cambridge davet human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. tap tandem affinity purification TAP TAP tap fingerprinting peptide massfingerprinting fingerprinting Burstein E., Hoberg JE., Wilkinson AS., Rumble JM., Csomos RA., Komarck CM., Maine GN., Wilkinson JC., Mayo MW., Duckett CS. Apoptosis - Interactions involving proteins with a function related to apoptosis MURR1-TAP was subsequently purified from cells lysates using two sequential chromatography columns containing IgG and calmodulin beads. The material obtained was subjected to tryptic digestion, and the peptides generated were then identified by tandem mass spectrometry (MS/MS) after initial separation using liquid chromatography. The origins of MURR1 determined based ont he back references provided in the publication; PMID: 14685266. colind@umich.edu Accepted 2007-DEC-15 by DAVET. 2007-10-15: W.H. Ouwehand, Department of Haematology, University of Cambridge J. Biol. Chem. (0021-9258) 2005 davet nfkb1_human Nuclear factor NF-kappa-B p105 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMMSNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQAHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGKI DIP protein P19838 original sequence version: 202 DIP protein P19838 original sequence version: 192 DIP protein P19838 original sequence version: 195 2A7C8FF86A10D1A8 nfkb2_human Nuclear factor NF-kappa-B p100 subunit NFKB2 LYT10 DNA-binding factor KBF2 H2TF1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 Oncogene Lyt-10 Lymphocyte translocation chromosome 10 protein protein protein human Homo sapiens Human MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGSGGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEAAEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHLLTAQDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQTSVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEGLYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRANVNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH DIP protein Q00653 original sequence version: 194 6BAD7038834783CA ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL DIP protein P25963 original sequence version: 160 DIP protein P25963 original sequence version: 157 DIP protein P25963 original sequence version: 145 DIP protein P25963 original sequence version: 170 DIP protein P25963 original sequence version: 122 DIP protein P25963 original sequence version: 128 DIP protein P25963 original sequence version: 78 DIP protein P25963 original sequence version: 121 DIP protein P25963 original sequence version: 124 088B313226786395 comd2_human COMM domain-containing protein 2 COMMD2 HSPC042 My004 protein protein human Homo sapiens Human MLLELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSDTVQHGVEGLTYLLTESSKLMISELDFQDSVFVLGFSEELNKLLLQLYLDNRKEIRTILSELAPSLPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALEEMKTNHCRRVVRNIK ECB4B7C26FCEA0F2 comda_human COMM domain-containing protein 10 COMMD10 HSPC305 PTD002 protein protein human Homo sapiens Human MAVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFSHKELFDFYNKLETIQAQLDSLT 4D3C014FE59188CB comd3_human COMM domain-containing protein 3 Protein Bup Protein PIL COMMD3 BUP C10orf8 protein protein human Homo sapiens Human MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQL AC757941FC17F757 comd8_human COMM domain-containing protein 8 COMMD8 MDS022 protein protein human Homo sapiens Human MEPEEGTPLWRLQKLPAELGPQLLHKIIDGICGRAYPVYQDYHTVWESEEWMHVLEDIAKFFKAIVGKNLPDEEIFQQLNQLNSLHQETIMKCVKSRKDEIKQALSREIVAISSAQLQDFDWQVKLALSSDKIAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQLK 59B48D6D7CECCCC7 comd9_human COMM domain-containing protein 9 COMMD9 HSPC166 protein protein human Homo sapiens Human MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK 54DA2FE525C3A24F comd4_human COMM domain-containing protein 4 COMMD4 protein protein human Homo sapiens Human MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG 7B7B85234E3FB59B comd5_human COMM domain-containing protein 5 COMMD5 HT002 Hypertension-related calcium-regulated gene protein protein protein human Homo sapiens Human MSAVGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQRLGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRVDVAISTSALARSLQPSVLMQLKLSDGSAYRFEVPTAKFQELRYSVALVLKEMADLEKRCERRLQD C4CC0563B9FA3240 relb_human Transcription factor RelB RELB I-Rel protein protein human Homo sapiens Human MLRSGPASGPSVPTGRAMPSRRVARPPAAPELGALGSPDLSSLSLAVSRSTDELEIIDEYIKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRLVSPAPGPGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVHRQIAIVFKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRKKKPAILDHFLPNHGSGPFLPPSALLPDPDFFSGTVSLPGLEPPGGPDLLDDGFAYDPTAPTLFTMLDLLPPAPPHASAVVCSGGAGAVVGETPGPEPLTLDSYQAPGPGDGGTASLVGSNMFPNHYREAAFGGGLLSPGPEAT C2C61C2C8640513E p19838-2 Nuclear factor NF-kappa-B p105 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMMSNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQAHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGKI B4D57AC8A410941D d3dr86_human NFKB2 hCG_25639 protein protein human Homo sapiens Human MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGSGGAAGGYGGAGGGEGVLMEGGVKVREAVEEKNLGEAGRGGSRL Ref.1 (CAA43716) sequence differs from that shown due to a frameshift in position 400. Also includes sequencing errors E6F7E2102EB686E5 comd7_human COMM domain-containing protein 7 COMMD7 C20orf92 protein protein human Homo sapiens Human MGRLHCTEDPVPEAVGGDMQQLNQLGAQQFSALTEVLFHFLTEPKEVERFLAQLSEFATTNQISLGSLRSIVKSLLLVPNGALKKSLTAKQVQADFITLGLSEEKATYFSEKWKQNAPTLARWAIGQTLMINQLIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKGNQTENVYIELTLPQFYSFLHEMERVRTSMECFC 41D483117729B495 rel_human Proto-oncogene c-Rel REL protein protein human Homo sapiens Human MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQV 03E1033BDF7B1B30 comd6_human COMM domain-containing protein 6 COMMD6 MSTP076 protein protein human Homo sapiens Human MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETV FBF29F240EA8756B comd1_human COMM domain-containing protein 1 COMMD1 C2orf5 MURR1 Protein Murr1 protein protein human Homo sapiens Human MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFNQLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHTPVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN 9C810AECA67011DC tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 commd1-commd3 4 21 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 20 unspecified role unspecified role prey prey association association 1A COMMD3, -4, and -6 were identified as COMMD1-associated factors in our TAP screen commd1-commd1 1 21 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role prey prey physical association physical association 3A COMMD1-8 and COMMD10 could readily precipitate endogenous COMMD1 commd2-commd1 1 21 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A COMMD1-8 and COMMD10 could readily precipitate endogenous COMMD1 commd3-commd1 1 21 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A COMMD1-8 and COMMD10 could readily precipitate endogenous COMMD1 commd4-commd1 1 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role prey prey physical association physical association 3A COMMD1-8 and COMMD10 could readily precipitate endogenous COMMD1 commd5-commd1 1 14 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role prey prey physical association physical association 3A COMMD1-8 and COMMD10 could readily precipitate endogenous COMMD1 commd6-commd1 1 20 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role prey prey physical association physical association 3A COMMD1-8 and COMMD10 could readily precipitate endogenous COMMD1 commd7-commd1 1 18 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role prey prey physical association physical association 3A COMMD1-8 and COMMD10 could readily precipitate endogenous COMMD1 commd8-commd1 1 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role prey prey physical association physical association 3A COMMD1-8 and COMMD10 could readily precipitate endogenous COMMD1 commd10-commd1 1 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role prey prey physical association physical association 3A COMMD1-8 and COMMD10 could readily precipitate endogenous COMMD1 commd1-commd1-1 3 21 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined exon2-3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 21 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3C The carboxyl terminus of COMMD1 (exon 2-3), which contains the COMM domain, was found to be sufficient for interactions with COMMD1 and COMMD3. commd1-commd3-1 3 21 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined exon2-3 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3D The carboxyl terminus of COMMD1 (exon 2-3), which contains the COMM domain, was found to be sufficient for interactions with COMMD1 and COMMD3. commd1-rela 2 19 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait association association 5A precipitation of endogenous COMMD1 with the use of rabbit polyclonal sera against COMMD1 resulted in the co-precipitation of endogenous RelA and c-Rel commd1-rela-1 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5B As was the case for COMMD1, most COMMD proteins were also capable of precipitating NF-{kappa}B complexes commd2-rela 1 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association 5B As was the case for COMMD1, most COMMD proteins were also capable of precipitating NF-{kappa}B complexes commd10-rela 1 15 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 22 unspecified role unspecified role prey prey association association 5B As was the case for COMMD1, most COMMD proteins were also capable of precipitating NF-{kappa}B complexes commd4-rela 1 13 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey association association 5B As was the case for COMMD1, most COMMD proteins were also capable of precipitating NF-{kappa}B complexes commd5-rela 1 5 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 22 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey association association 5B As was the case for COMMD1, most COMMD proteins were also capable of precipitating NF-{kappa}B complexes commd8-rela 1 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey association association 5B As was the case for COMMD1, most COMMD proteins were also capable of precipitating NF-{kappa}B complexes commd3-relb 1 15 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5B As was the case for COMMD1, most COMMD proteins were also capable of precipitating NF-{kappa}B complexes commd9-relb 1 15 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5B As was the case for COMMD1, most COMMD proteins were also capable of precipitating NF-{kappa}B complexes commd6-rela 1 20 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey 22 unspecified role unspecified role prey prey association association 5B As was the case for COMMD1, most COMMD proteins were also capable of precipitating NF-{kappa}B complexes commd7-rela 1 5 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 22 unspecified role unspecified role prey prey association association 5B As was the case for COMMD1, most COMMD proteins were also capable of precipitating NF-{kappa}B complexes commd1-rela-2 3 22 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6A COMMD1-RelA interactions are only detectable with full-length COMMD1 COMMD1-RelA interactions are only detectable with full-length COMMD1 rela-commd1 1 22 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rhd domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 21 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association 6C RHD of RelA was sufficient for binding to COMMD1, p50 or p105, and I{kappa}B-{alpha}. rela-commd1-1 1 21 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait rhd domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6D, 6C homologous regions, present in the RHD of all five NF-{kappa}B subunits, were capable of binding to COMMD1. rel-commd1 1 21 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait rhd domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 6D homologous regions, present in the RHD of all five NF-{kappa}B subunits, were capable of binding to COMMD1. relb-commd1 1 15 unspecified role unspecified role bait bait rhd domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role prey prey physical association physical association 6D homologous regions, present in the RHD of all five NF-{kappa}B subunits, were capable of binding to COMMD1. nfkb1-commd1 1 16 unspecified role unspecified role bait bait rhd domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role prey prey physical association physical association 6D homologous regions, present in the RHD of all five NF-{kappa}B subunits, were capable of binding to COMMD1. nfkb2-commd1 1 21 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rhd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 6D homologous regions, present in the RHD of all five NF-{kappa}B subunits, were capable of binding to COMMD1.