UniProt UniProt http://www.uniprot.org Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. EMBO J. (0261-4189) 2005 mimix curation Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis created new cell lines/organism for -jca1 and -276b1. you may check. FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu 21-Dec-2011: Contacted by JYOTI. human-du_145 Homo sapiens DU-145 prostate cancer cell line du_145 DU-145 Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis created new cell lines/organism for -jca1 and -276b1. you may check. FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu Accepted 2011-NOV-14 by JYOTI 21-Dec-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2005 mimix curation Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. EMBO J. (0261-4189) 2005 mimix curation Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis created new cell lines/organism for -jca1 and -276b1. you may check. FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu 21-Dec-2011: Contacted by JYOTI. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis created new cell lines/organism for -jca1 and -276b1. you may check. FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu Accepted 2011-NOV-14 by JYOTI 21-Dec-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2005 mimix curation Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. EMBO J. (0261-4189) 2005 mimix curation Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis created new cell lines/organism for -jca1 and -276b1. you may check. FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu 21-Dec-2011: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis created new cell lines/organism for -jca1 and -276b1. you may check. FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu Accepted 2011-NOV-14 by JYOTI EMBO J. (0261-4189) 2005 mimix curation Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. EMBO J. (0261-4189) 2005 mimix curation Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis created new cell lines/organism for -jca1 and -276b1. you may check. FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu 21-Dec-2011: Contacted by JYOTI. human-du_145 Homo sapiens DU-145 prostate cancer cell line du_145 DU-145 Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP imaging technique imaging technique microscopy anti tag immunost anti tag immunostaining anti tag immunost Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis created new cell lines/organism for -jca1 and -276b1. you may check. FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu Accepted 2011-NOV-14 by JYOTI 21-Dec-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2005 mimix curation Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. EMBO J. (0261-4189) 2005 mimix curation Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis created new cell lines/organism for -jca1 and -276b1. you may check. FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu 21-Dec-2011: Contacted by JYOTI. human-jca1 Homo sapiens JCA-1 prostate cancer cells jca1 JCA1 prostate cancer cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis created new cell lines/organism for -jca1 and -276b1. you may check. FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu Accepted 2011-NOV-14 by JYOTI 21-Dec-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2005 mimix curation Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. EMBO J. (0261-4189) 2005 mimix curation Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis created new cell lines/organism for -jca1 and -276b1. you may check. FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu 21-Dec-2011: Contacted by JYOTI. human-276b1 Homo sapiens 276B1 prostate epithelial cells 276b1 276B1 prostate epithelial cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis created new cell lines/organism for -jca1 and -276b1. you may check. FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu Accepted 2011-NOV-14 by JYOTI 21-Dec-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2005 mimix curation Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. Suppression of FOXO1 activity by FHL2 through SIRT1-mediated deacetylation. EMBO J. (0261-4189) 2005 mimix curation Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis created new cell lines/organism for -jca1 and -276b1. you may check. FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu 21-Dec-2011: Contacted by JYOTI. human-du_145 Homo sapiens DU-145 prostate cancer cell line du_145 DU-145 Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yang Y., Hou H., Haller E.M., Nicosia S.V., Bai W. Apoptosis - Interactions involving proteins with a function related to apoptosis created new cell lines/organism for -jca1 and -276b1. you may check. FOXO1 origin according pmid 10358014 and 12482965. SIRT1 origin according pmid 11672523. wbai@hsc.usf.edu Accepted 2011-NOV-14 by JYOTI 21-Dec-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2005 mimix curation sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS DIP protein Q96EB6 original sequence version: 140 DIP protein Q96EB6 original sequence version: 71 DIP protein Q96EB6 original sequence version: 125 DIP protein Q96EB6 original sequence version: 115 DIP protein Q96EB6 original sequence version: 63 DIP protein Q96EB6-1 original sequence version: 102 DIP protein Q96EB6 original sequence version: 102 DIP protein Q96EB6 original sequence version: 98 DIP protein Q96EB6 original sequence version: 144 DIP protein Q96EB6 original sequence version: 120 DIP protein Q96EB6-1 original sequence version: 120 DIP protein Q96EB6 original sequence version: 113 DIP protein Q96EB6-1 original sequence version: 117 2D3BEA6D73DA229F foxo1_human Forkhead box protein O1 FOXO1 FKHR FOXO1A Forkhead box protein O1A Forkhead in rhabdomyosarcoma protein protein human Homo sapiens Human MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG DIP protein Q12778 original sequence version: 132 DIP protein Q12778 original sequence version: 84 6DEF6C994BDFDBAB fhl2_human Four and a half LIM domains protein 2 Skeletal muscle LIM-protein 3 LIM domain protein DRAL FHL2 DRAL SLIM3 protein protein human Homo sapiens Human MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI DIP protein Q14192 original sequence version: null DIP protein Q14192 original sequence version: 142 DIP protein Q14192 original sequence version: 136 E94E3A7F6601F9F3 foxo1-fhl2 3 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association no figure foxo1-fhl2-1 1 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 1A fhl2-foxo1 1 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 1A FHL2 decreases FOXO1 acetylation by promoting the interaction of FOXO1 and SIRT1 fhl2-foxo1-1 2 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 1C fhl2-foxo1-2 4 9 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 1B foxo1-fhl2-2 7 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 4C foxo1-fhl2-3 5 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 4C foxo1-fhl2-4 6 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 4C sirt1-foxo1 1 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 7A foxo1-sirt1 1 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 7A and 8B Enhanced by FHL2 (AC Q14192) fhl2-sirt1 1 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 8A sirt1-fhl2 1 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 8A