IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A systematic scan of interactions with tyrosine motifs in the erythropoietin receptor using a mammalian 2-hybrid approach. A systematic scan of interactions with tyrosine motifs in the erythropoietin receptor using a mammalian 2-hybrid approach. Blood (0006-4971) 2005 Montoye T., Lemmens I., Catteeuw D., Eyckerman S., Tavernier J. Apoptosis - Interactions involving proteins with a function related to apoptosis MAPPIT bait construct - a chimeric cytokine receptor composed of the extracellular region of homodimeric EpoR, fused to the transmembrane and cytosolic domains of the leptin receptor wherein all the tyrosine residues are mutated to phenylalanines. A bait, consisting of a section of the cytoplasmic domain of EpoR is C-terminally fused to this signaling-deficient receptor. The interaction is detected via activation of STAT3 and a subsequent reporter gene activation. 2 jan.tavernier@ugent.be human-tf1 Human erythroleukaemia TF1 cells tf1 Human erythroleukaemia TF1 cells mappit mammalian protein protein interaction trap mappit predetermined predetermined participant predetermined Montoye T., Lemmens I., Catteeuw D., Eyckerman S., Tavernier J. Apoptosis - Interactions involving proteins with a function related to apoptosis MAPPIT bait construct - a chimeric cytokine receptor composed of the extracellular region of homodimeric EpoR, fused to the transmembrane and cytosolic domains of the leptin receptor wherein all the tyrosine residues are mutated to phenylalanines. A bait, consisting of a section of the cytoplasmic domain of EpoR is C-terminally fused to this signaling-deficient receptor. The interaction is detected via activation of STAT3 and a subsequent reporter gene activation. 2 jan.tavernier@ugent.be Blood (0006-4971) 2005 A systematic scan of interactions with tyrosine motifs in the erythropoietin receptor using a mammalian 2-hybrid approach. A systematic scan of interactions with tyrosine motifs in the erythropoietin receptor using a mammalian 2-hybrid approach. Blood (0006-4971) 2005 Montoye T., Lemmens I., Catteeuw D., Eyckerman S., Tavernier J. Apoptosis - Interactions involving proteins with a function related to apoptosis MAPPIT bait construct - a chimeric cytokine receptor composed of the extracellular region of homodimeric EpoR, fused to the transmembrane and cytosolic domains of the leptin receptor wherein all the tyrosine residues are mutated to phenylalanines. A bait, consisting of a section of the cytoplasmic domain of EpoR is C-terminally fused to this signaling-deficient receptor. The interaction is detected via activation of STAT3 and a subsequent reporter gene activation. 2 jan.tavernier@ugent.be human-a_431 Homo sapiens epidermoid carcinoma a_431 Human epidermoid carcinoma mappit mammalian protein protein interaction trap mappit predetermined predetermined participant predetermined Montoye T., Lemmens I., Catteeuw D., Eyckerman S., Tavernier J. Apoptosis - Interactions involving proteins with a function related to apoptosis MAPPIT bait construct - a chimeric cytokine receptor composed of the extracellular region of homodimeric EpoR, fused to the transmembrane and cytosolic domains of the leptin receptor wherein all the tyrosine residues are mutated to phenylalanines. A bait, consisting of a section of the cytoplasmic domain of EpoR is C-terminally fused to this signaling-deficient receptor. The interaction is detected via activation of STAT3 and a subsequent reporter gene activation. 2 jan.tavernier@ugent.be Blood (0006-4971) 2005 A systematic scan of interactions with tyrosine motifs in the erythropoietin receptor using a mammalian 2-hybrid approach. A systematic scan of interactions with tyrosine motifs in the erythropoietin receptor using a mammalian 2-hybrid approach. Blood (0006-4971) 2005 Montoye T., Lemmens I., Catteeuw D., Eyckerman S., Tavernier J. Apoptosis - Interactions involving proteins with a function related to apoptosis MAPPIT bait construct - a chimeric cytokine receptor composed of the extracellular region of homodimeric EpoR, fused to the transmembrane and cytosolic domains of the leptin receptor wherein all the tyrosine residues are mutated to phenylalanines. A bait, consisting of a section of the cytoplasmic domain of EpoR is C-terminally fused to this signaling-deficient receptor. The interaction is detected via activation of STAT3 and a subsequent reporter gene activation. 2 jan.tavernier@ugent.be human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. mappit mammalian protein protein interaction trap mappit predetermined predetermined participant predetermined Montoye T., Lemmens I., Catteeuw D., Eyckerman S., Tavernier J. Apoptosis - Interactions involving proteins with a function related to apoptosis MAPPIT bait construct - a chimeric cytokine receptor composed of the extracellular region of homodimeric EpoR, fused to the transmembrane and cytosolic domains of the leptin receptor wherein all the tyrosine residues are mutated to phenylalanines. A bait, consisting of a section of the cytoplasmic domain of EpoR is C-terminally fused to this signaling-deficient receptor. The interaction is detected via activation of STAT3 and a subsequent reporter gene activation. 2 jan.tavernier@ugent.be Blood (0006-4971) 2005 ship1_human Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 INPP5D SHIP SHIP1 Inositol polyphosphate-5-phosphatase of 145 kDa p150Ship SH2 domain-containing inositol 5'-phosphatase 1 Inositol polyphosphate-5-phosphatase D Phosphatidylinositol 4,5-bisphosphate 5-phosphatase protein protein human Homo sapiens Human MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQYPVPLEEEDTGDDPEEDTVESVVSPPELPPRNIPLTASSCEAKEVPFSNENPRATETSRPSLSETLFQRLQSMDTSGLPEEHLKAIQDYLSTQLAQDSEFVKTGSSSLPHLKKLTTLLCKELYGEVIRTLPSLESLQRLFDQQLSPGLRPRPQVPGEANPINMVSKLSQLTSLLSSIEDKVKALLHEGPESPHRPSLIPPVTFEVKAESLGIPQKMQLKVDVESGKLIIKKSKDGSEDKFYSHKKILQLIKSQKFLNKLVILVETEKEKILRKEYVFADSKKREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNAPPPKKITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLSEKEWLEILKHSLQEITSVTFKTVAIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNSHLTSGSEKKLRRNQNYMNILRFLALGDKKLSPFNITHRFTHLFWFGDLNYRVDLPTWEAETIIQKIKQQQYADLLSHDQLLTERREQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFVSKNGPGTVDSQGQIEFLRCYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELVVKFGETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLEATETQLPIYTPLTHHGELTGHFQGEIKLQTSQGKTREKLYDFVKTERDESSGPKTLKSLTSHDPMKQWEVTSRAPPCSGSSITEIINPNYMGVGPFGPPMPLHVKQTLSPDQQPTAWSYDQPPKDSPLGPCRGESPPTPPGQPPISPKKFLPSTANRGLPPRTQESRPSDLGKNAGDTLPQEDLPLTKPEMFENPLYGSLSSFPKPAPRKDQESPKMPRKEPPPCPEPGILSPSIVLTKAQEADRGEGPGKQVPAPRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKRPIKPSRSEINQQTPPTPTPRPPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPLGRTAMQ 7958E91A64A4B68B epor_human Erythropoietin receptor EPOR protein protein human Homo sapiens Human MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTHKGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVGSEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS DIP protein P19235 original sequence version: 168 DIP protein P19235 original sequence version: 186 F9F326E162E9512A plcg2_human 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 Phosphoinositide phospholipase C-gamma-2 Phospholipase C-gamma-2 Phospholipase C-IV PLCG2 protein protein human Homo sapiens Human MSTTVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADKIEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAVNWLSGLKILHQEAMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSAKFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASAVYLHDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENSIWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDCWDGPDGKPVIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRHMAKAFKEVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGELYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKKVEKRTSAEKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYYLTDNLTFSSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDMLMRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYYEKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDYKAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADFEELEKQIIEDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKQQGDPPVEFATDRVEELFEWFQSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVETKADSIIRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTADKYMQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSIACPFVEVEICGAEYDNNKFKTTVVNDNGLSPIWAPTQEKVTFEIYDPNLAFLRFVVYEEDMFSDPNFLAHATYPIKAVKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSCRQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFSVNENQLQLYQEKCNKRLREKRVSNSKFYS 1D56BCBF51D7A0D3 sta5a_mouse Signal transducer and activator of transcription 5A Mammary gland factor Stat5a Mgf Mpf protein protein mouse Mus musculus Mouse MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRGQATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNCSSPAGVLVDAMSQKHLQINQRFEELRLITQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLGQLNPQERMSRETALQQKQVSLETWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNISSNHLEDYNSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVFAKYYTPVLAKAVDGYVKPQIKQVVPEFVNASTDAGASATYMDQAPSPVVCPQPHYNMYPPNPDPVLDQDGEFDLDESMDVARHVEELLRRPMDSLDARLSPPAGLFTSARSSLS 7C66E435C37624DD socs2_mouse Suppressor of cytokine signaling 2 Cytokine-inducible SH2 protein 2 Socs2 Cis2 Cish2 protein protein mouse Mus musculus Mouse MTLRCLEPSGNGADRTRSQWGTAGLPEEQSPEAARLAKALRELSQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPTLQHFCRLAINKCTGTIWGLPLPTRLKDYLEEYKFQV C9051AE9C84BA7F5 cish_mouse Cytokine-inducible SH2-containing protein CIS-1 Suppressor of cytokine signaling Cish Cis protein protein mouse Mus musculus Mouse MVLCVQGSCPLLAVEQIGRRPLWAQSLELPGPAMQPLPTGAFPEEVTEETPVQAENEPKVLDPEGDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDPAPTPALPMSKQDAPSDSVLPIPVATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCLPLPRRMADYLRQYPFQL F14FD8B370B9A005 sta5b_mouse Signal transducer and activator of transcription 5B Stat5b protein protein mouse Mus musculus Mouse MAMWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQSTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLITQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLGQLNPQERMSRETALQQKQVSLETWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRSDRRGAESVTEEKFTILFDSQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNISSNHLEDYNSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAADGYVKPQIKQVVPEFANASTDAGSGATYMDQAPSPVVCPQAHYNMYPPNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS A8FE76405E41B2EF epor-socs2-1 3 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain physical association physical association epor-ship1-1 3 4 unspecified role unspecified role prey prey sh2 region binding region binding-associated region binding region mutation analysis mutation analysis range range range range 5 unspecified role unspecified role bait bait region binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain 19 17 physical association physical association Paper does not give exact construct of SH2 domain of SHIP1, ProSite domain boundaries have therefore been used to describe binding site. epor-plcg21-1 3 6 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis range range range range phe561ala-arg564ala required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait region binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain 25 22 physical association physical association Paper does not give exact construct of SH2 domains of PLCgamma, ProSite domain boundaries have therefore been used to describe binding site. epor-stat5a-1 3 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain physical association physical association epor-stat5b-1 3 5 unspecified role unspecified role bait bait region binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey physical association physical association epor-cish-1 3 5 unspecified role unspecified role bait bait region binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey physical association physical association epor-cish-2 3 5 unspecified role unspecified role bait bait region binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P19235:p.Tyr454Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Thu Jul 07 12:07:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was tyr454phe Wed May 02 14:42:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr454phe' Tue Jun 30 19:15:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr454Phe' 9 unspecified role unspecified role prey prey physical association physical association Weak binding observed to this region epor-cish-3 2 5 unspecified role unspecified role bait bait P19235:p.Tyr426Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Thu Jul 07 12:15:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was tyr426phe Wed May 02 18:05:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr426phe' Tue Jun 30 17:00:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr426Phe' 9 unspecified role unspecified role prey prey physical association physical association epor-socs2-2 2 5 unspecified role unspecified role bait bait P19235:p.Tyr426Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Thu Jul 07 12:15:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was tyr426phe Wed May 02 17:50:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr426phe' Tue Jun 30 19:55:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr426Phe' 8 unspecified role unspecified role prey prey physical association physical association epor-plcg21-2 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait P19235:p.Tyr504Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Thu Jul 07 12:06:53 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was tyr504phe Wed May 02 18:30:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr504phe' Tue Jun 30 15:59:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr504Phe' P19235:p.Tyr456Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Thu Jul 07 12:18:36 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was tyr456phe Wed May 02 16:07:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr456phe' Tue Jun 30 17:53:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr456Phe' physical association physical association Paper does not give exact construct of SH2 domains of PLCgamma, ProSite domain boundaries have therefore been used to describe binding site. epor-plcg21-3 1 5 unspecified role unspecified role bait bait P19235:p.Tyr504Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Thu Jul 07 12:07:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was tyr504phe Wed May 02 16:31:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr504phe' Tue Jun 30 19:06:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr504Phe' P19235:p.Tyr456Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y F Thu Jul 07 12:07:40 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was tyr456phe Wed May 02 16:13:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr456phe' Tue Jun 30 18:02:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr456Phe' 6 unspecified role unspecified role prey prey P16885:p.Lys367Phe mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K F Fri Jul 22 11:07:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr368phe' Wed May 02 16:17:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys367phe' Tue Jun 30 18:45:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys367Phe' physical association physical association Paper does not give exact construct of SH2 domains of PLCgamma, ProSite domain boundaries have therefore been used to describe binding site.