IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases Genes Dev 2004 imex curation Takumi Kamura, Katsumi Maenaka, Shuhei Kotoshiba, Masaki Matsumoto, Daisuke Kohda, Ronald C. Conaway, Joan Weliky Conaway, Keiichi I. Nakayama Apoptosis - Interactions involving proteins with a function related to apoptosis nakayak1@bioreg.kyushu-u.ac.jp 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions Curation by: Molecular Connections Pvt. Ltd human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Takumi Kamura, Katsumi Maenaka, Shuhei Kotoshiba, Masaki Matsumoto, Daisuke Kohda, Ronald C. Conaway, Joan Weliky Conaway, Keiichi I. Nakayama Apoptosis - Interactions involving proteins with a function related to apoptosis nakayak1@bioreg.kyushu-u.ac.jp Accepted 2010-JUN-19 by ORCHARD. Genes Dev 2004 orchard Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases Genes Dev 2004 imex curation Takumi Kamura, Katsumi Maenaka, Shuhei Kotoshiba, Masaki Matsumoto, Daisuke Kohda, Ronald C. Conaway, Joan Weliky Conaway, Keiichi I. Nakayama Apoptosis - Interactions involving proteins with a function related to apoptosis nakayak1@bioreg.kyushu-u.ac.jp 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions Curation by: Molecular Connections Pvt. Ltd human-786_o Homo sapiens renal cell adenocarcinoma 786_o Human renal cell adenocarcinoma cell line CRL-1932 is the ATCC identifier. ATCC identifier is CRL-1932. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Takumi Kamura, Katsumi Maenaka, Shuhei Kotoshiba, Masaki Matsumoto, Daisuke Kohda, Ronald C. Conaway, Joan Weliky Conaway, Keiichi I. Nakayama Apoptosis - Interactions involving proteins with a function related to apoptosis nakayak1@bioreg.kyushu-u.ac.jp Accepted 2010-JUN-19 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Genes Dev 2004 orchard Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases Genes Dev 2004 imex curation Takumi Kamura, Katsumi Maenaka, Shuhei Kotoshiba, Masaki Matsumoto, Daisuke Kohda, Ronald C. Conaway, Joan Weliky Conaway, Keiichi I. Nakayama Apoptosis - Interactions involving proteins with a function related to apoptosis nakayak1@bioreg.kyushu-u.ac.jp 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions Curation by: Molecular Connections Pvt. Ltd human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Takumi Kamura, Katsumi Maenaka, Shuhei Kotoshiba, Masaki Matsumoto, Daisuke Kohda, Ronald C. Conaway, Joan Weliky Conaway, Keiichi I. Nakayama Apoptosis - Interactions involving proteins with a function related to apoptosis nakayak1@bioreg.kyushu-u.ac.jp Accepted 2010-JUN-19 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Genes Dev 2004 orchard Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases Genes Dev 2004 imex curation Takumi Kamura, Katsumi Maenaka, Shuhei Kotoshiba, Masaki Matsumoto, Daisuke Kohda, Ronald C. Conaway, Joan Weliky Conaway, Keiichi I. Nakayama Apoptosis - Interactions involving proteins with a function related to apoptosis nakayak1@bioreg.kyushu-u.ac.jp 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions Curation by: Molecular Connections Pvt. Ltd mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Takumi Kamura, Katsumi Maenaka, Shuhei Kotoshiba, Masaki Matsumoto, Daisuke Kohda, Ronald C. Conaway, Joan Weliky Conaway, Keiichi I. Nakayama Apoptosis - Interactions involving proteins with a function related to apoptosis nakayak1@bioreg.kyushu-u.ac.jp Accepted 2010-JUN-19 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Genes Dev 2004 orchard Only protein-protein interactions imex curation Curation by: Molecular Connections Pvt. Ltd eloc_mouse Elongin-C Eloc Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 Stromal membrane-associated protein SMAP1B homolog Tceb1 Transcription elongation factor B polypeptide 1 protein protein mouse Mus musculus Mouse MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC DIP protein P83940 original sequence version: 92 98D88696E883538B vhl-m1_human_protein VHL-SPSB1 chimeric protein protein protein human Homo sapiens Human MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENHTLPLPASLKAYLLYQ An amino acid sequence which is not represented in UniProt Chimeric protein created from VHL (P40337) and SPSB1 (Q96BD6) 15CEA88148C7D5F1 vhl_human von Hippel-Lindau disease tumor suppressor VHL pVHL Protein G7 protein protein human Homo sapiens Human MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD DIP protein P40337 original sequence version: 176 DIP protein P40337 original sequence version: 103 DIP protein P40337-1 original sequence version: 177 DIP protein P40337 original sequence version: 160 DIP protein P40337 original sequence version: 175 BA5D6765FBC16EA7 cul2_human Cullin-2 CUL2 protein protein human Homo sapiens Human MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTETKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVLLRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKDTPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA DIP protein Q13617 original sequence version: 129 DIP protein Q13617 original sequence version: 127 DIP protein Q13617-1 original sequence version: 139 DIP protein Q13617 original sequence version: 111 DIP protein Q13617 original sequence version: 102 30647248F671AB0E rbx2_human RING-box protein 2 RNF7 RBX2 ROC2 SAG RING finger protein 7 Regulator of cullins 2 CKII beta-binding protein 1 Sensitive to apoptosis gene protein protein protein human Homo sapiens Human MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK CE1E6CAC940C8257 vhl_mouse von Hippel-Lindau disease tumor suppressor pVHL Vhlh Vhl protein protein mouse Mus musculus Mouse MPRKAASPEEAAGEPGPEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPLWLNFDGEPQPYPILPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDYPSVRKDIQRLSQEHLESQHLEEEP AE8B2E8DDD3EE987 spsb4_human SPRY domain-containing SOCS box protein 4 SPSB4 SSB4 protein protein human Homo sapiens Human MGQKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRHAWNPEDRSLNVFVKDDDRLTFHRHPVAQSTDGIRGKVGHARGLHAWQINWPARQRGTHAVVGVATARAPLHSVGYTALVGSDAESWGWDLGRSRLYHDGKNQPGVAYPAFLGPDEAFALPDSLLVVLDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEVTMRYINGLDPEPLPLMDLCRRSIRSALGRQRLQDISSLPLPQSLKNYLQYQ 234A651A08217489 rbx2_mouse RING-box protein 2 RING finger protein 7 Sensitive to apoptosis gene protein Rbx2 Sag Rnf7 protein protein mouse Mus musculus Mouse MADVEDGEEPCVLSSHSGSAGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK D6FA02EE6038FDD2 socs3_human Suppressor of cytokine signaling 3 Cytokine-inducible SH2 protein 3 STAT-induced STAT inhibitor 3 SOCS3 CIS3 SSI3 protein protein human Homo sapiens Human MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL 08581DC411EFFF19 elob_human Elongin-B ELOB Elongin 18 kDa subunit RNA polymerase II transcription factor SIII subunit B SIII p18 TCEB2 Transcription elongation factor B polypeptide 2 protein protein human Homo sapiens Human MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ C045F58FBED0EC47 llr1_human Leucine-rich repeat protein 1 LRR1 PPIL5 LRR-repeat protein 1 4-1BB-mediated-signaling molecule 4-1BBlrr Peptidylprolyl isomerase-like 5 protein protein human Homo sapiens Human MKLHCEVEVISRHLPALGLRNRGKGVRAVLSLCQQTSRSQPPVRAFLLISTLKDKRGTRYELRENIEQFFTKFVDEGKATVRLKEPPVDICLSKAISSSLKGFLSAMRLAHRGCNVDTPVSTLTPVKTSEFENFKTKMVITSKKDYPLSKNFPYSLEHLQTSYCGLVRVDMRMLCLKSLRKLDLSHNHIKKLPATIGDLIHLQELNLNDNHLESFSVALCHSTLQKSLRSLDLSKNKIKALPVQFCQLQELKNLKLDDNELIQFPCKIGQLINLRFLSAARNKLPFLPSEFRNLSLEYLDLFGNTFEQPKVLPVIKLQAPLTLLESSARTILHNRIPYGSHIIPFHLCQDLDTAKICVCGRFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDMLK B19B178D6CB33C4C rbx1_human E3 ubiquitin-protein ligase RBX1 RBX1 RNF75 ROC1 Regulator of cullins 1 RING finger protein 75 Protein ZYP RING-box protein 1 E3 ubiquitin-protein transferase RBX1 protein protein human Homo sapiens Human MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH DIP protein P62877 original sequence version: 120 DIP protein P62877 original sequence version: 115 DIP protein P62877 original sequence version: 78 DIP protein P62877 original sequence version: 113 DIP protein P62877 original sequence version: 75 DIP protein P62877 original sequence version: 86 DIP protein P62877 original sequence version: 136 DIP protein P62877 original sequence version: 126 DIP protein P62877 original sequence version: 90 DIP protein P62877 original sequence version: 114 30FC5ADF66096C0E socs3_mouse Suppressor of cytokine signaling 3 Cytokine-inducible SH2 protein 3 Protein EF-10 Cis3 Cish3 Socs3 protein protein mouse Mus musculus Mouse MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGTPSFSLPPTEPSSEVPEQPPAQALPGSTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL DIP protein O35718 original sequence version: 61 DIP protein O35718 original sequence version: 119 DIP protein O35718 original sequence version: 93 CD3859561D4CCDED eloc_human Elongin-C ELOC Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 TCEB1 Transcription elongation factor B polypeptide 1 protein protein human Homo sapiens Human MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 98D88696E883538B rb40c_human Ras-related protein Rab-40C SOCS box-containing protein RAR3 Rar-like protein Ras-like protein family member 8C RAB40C RARL RASL8C protein protein human Homo sapiens Human MGSQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDGRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVPRILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHGMEKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRSYSLASGAGGGGSKGNSLKRSKSIRPPQSPPQNCSRSNCKIS 478F974645AA91EC wsb1_mouse WD repeat and SOCS box-containing protein 1 Wsb1 protein protein mouse Mus musculus Mouse MASFPPRVNEKEIVRSRTIGELLAPAAPFDKKCGGENWTVAFAPDGSYFAWSQGYRIVKLVPWSQCRKNFLLHGSKNVTNSSCLKLARQNSNGGQKNKPPEHVIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYTGKLLLNLVDHIEMVRDLTFAPDGSLLLVSASRDKTLRVWDLKDDGNMVKVLRAHQNWVYSCAFSPDCSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRVYVWDPHNGDLLMEFGHLFPSPTPIFAGGANDRWVRAVSFSHDGLHVASLADDKMVRFWRIDEDCPVQVAPLSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHICRMSIRRVMSTQEVQKLPVPSKILAFLSYRG 4003D1FFE7A9A2EF lrc41_mouse Leucine-rich repeat-containing protein 41 Protein Muf1 Muf1 Lrrc41 protein protein mouse Mus musculus Mouse MAAPEAWRARSCWFCEVAAATTMEATSREAAPAKSSASGPSAPPALFELCGRAVSAHMGVLESGVWALPGPILQSILPLLNIYYLERIEETALKKGLSTQAIWRRLWDELMKTRPSSLESVTCWRAKFMEAFFSHVLRGTIDVSSDKRLCDQRFSPLLHSSRHVRQLTICNMLQGATELVAEPNRRVLETLASSLHTLKFRHLLFSDVAAQQSLRQLLHQLIHHGAVSQVSLYSWPVPESALFILILTMSAGFWQPGPGSLPCRLCGEASRGRAPSRDEGSLLLGSRRPRRDAAERCAAALMATRRKSEVKQMPRAVPPTRVTRRSTQESLAIGGTDSKLYLPATSYEASGTKQPSAPAAASASSSTSSKRAPASSASQPKPLKRFKRAAGKKGPRTRQGSGAESEDLYDFVFIVAGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRFRSISTLELFTVPLSTEAALTLCHLLSSWVSLESLTLSYNGLGSNIFRLLDSLRALSGQAGCRLRALHLSDLFSPLPILELTRAIVRALPLLRVLSIRVDHPSQRDNPAVPENAGPPGHIVGDEEIPENCLEQLEMGFPRGAQPAPLLCSVLKASGSLQQLSLDSATFASPQDFGLVLQTLKEHNLSLKRLSFHDMNLADCQSEVLFLLKNLTLQEITFSFCRLFEKRPVQFLPEMVAAMKGNSTLKGLRLPGNRLGNAGLLALADVFSEDSSSSLCQLDISSNCIKPDGLLEFAKRLERWGRGAFGHLRLFQNWLDQDAVTAREAIRRLRATCHVVSDSWDSTQAFADYVSTM 79F6BBF2D4A33B97 rbx1_mouse E3 ubiquitin-protein ligase RBX1 RING finger protein 75 RING-box protein 1 Rbx1 E3 ubiquitin-protein transferase RBX1 protein protein mouse Mus musculus Mouse MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH 30FC5ADF66096C0E spsb1_human SPRY domain-containing SOCS box protein 1 SSB1 SPSB1 protein protein human Homo sapiens Human MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSVRLALGRERLGEIHTLPLPASLKAYLLYQ F93D5690A32403DF cul5_mouse Cullin-5 Cul5 protein protein mouse Mus musculus Mouse MATSNLLKNKGSLQFEDKWDFMHPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGSSKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEVTLLGKQSSNKKSNMEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKEEEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLMDKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYDPQVNSPKDFTEGTLFSVNQDFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQMEWLIEHRYIRRDEADINTFIYMA C6EE7A1AF1038C0D spsb2_human SPRY domain-containing SOCS box protein 2 SPSB2 GRCC9 SSB2 Gene-rich cluster protein C9 protein protein human Homo sapiens Human MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAALLGSNSESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGERRAEPHSLLHLSRLCVRHNLGDTRLGQVSALPLPPAMKRYLLYQ 0729EDDD0B598665 cul2_mouse Cullin-2 Cul2 protein protein mouse Mus musculus Mouse MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYAETKIFLESHVRHLYKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQYIKKNKLTEADIQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQNILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQGIFVSPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHSECHSIIQQERKNDMANMYVLLRAVSSGLPHMIEELQKHIHDEGLRATSNLTQEHMPTLFVESVLEVHGKFVQLINTVLNGDQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIRNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMSFSSKRTKFKITTSMQKDTPQELEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA 311C05CC262692E0 fem1b_human Protein fem-1 homolog B FEM1B KIAA0396 F1AA FEM1-beta Fem-1-like death receptor-binding protein alpha Fem-1-like in apoptotic pathway protein alpha protein protein human Homo sapiens Human MEGLAGYVYKAASEGKVLTLAALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGHAKVVRLLLEHYRVQTQQTGTVRFDGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVTNSTPLRAACFDGRLDIVKYLVENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQRADPNAKAHCGATALHFAAEAGHIDIVKELIKWRAAIVVNGHGMTPLKVAAESCKADVVELLLSHADCDRRSRIEALELLGASFANDRENYDIIKTYHYLYLAMLERFQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIYRGAVYADNMEFEQCIKLWLHALHLRQKGNRNTHKDLLRFAQVFSQMIHLNETVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHLAVNSNTPVDDFHTNDVCSFPNALVTKLLLDCGAEVNAVDNEGNSALHIIVQYNRPISDFLTLHSIIISLVEAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEEFVGFH DIP protein Q9UK73 original sequence version: 122 85DA943663A988C1 socs1_mouse Suppressor of cytokine signaling 1 JAK-binding protein STAT-induced STAT inhibitor 1 Cish1 Ssi1 Socs1 protein protein mouse Mus musculus Mouse MVARNQVAADNAISPAAEPRRRSEPSSSSSSSSPAAPVRPRPCPAVPAPAPGDTHFRTFRSHSDYRRITRTSALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRETFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVAAVGRENLARIPLNPVLRDYLSSFPFQI 4621E05DC3D44C69 cul5_human Cullin-5 CUL5 VACM1 Vasopressin-activated calcium-mobilizing receptor 1 protein protein human Homo sapiens Human MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSNKKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKEEEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLMDKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDFTEGTLFSVNQEFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA DIP protein Q93034 original sequence version: 160 DIP protein Q93034 original sequence version: 128 DIP protein Q93034 original sequence version: 126 DIP protein Q93034 original sequence version: 142 DIP protein Q93034 original sequence version: 96 57463CB4ED76E303 vhl-m2_human_protein VHL-RAR3 chimeric protein protein protein human Homo sapiens Human MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENIDKLPLPVTIKSHLKSFSMAN An amino acid sequence which is not represented in UniProt Chimeric protein created from VHL (P40337) and RAR3 (Q96S21) FDD508C023A182C6 elob_mouse Elongin-B Elob Elongin 18 kDa subunit RNA polymerase II transcription factor SIII subunit B SIII p18 Tceb2 Transcription elongation factor B polypeptide 2 protein protein mouse Mus musculus Mouse MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ BA702F24CEC0FC02 vhl-cul2-1 1 16 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 14 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey association association Fig 2A and Fig 5E Coimmunoprecipitation of HEK293T cells stably transfected with VHL-Flag tagged construct showed association with Cul2, Rbx1, Elongin B and Elongin C; region 178-181 (LDIV) is necessary for binding Cul2 and Rbx1 and not Elongin B and C vhl-cul2-2 3 14 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 18 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association Fig 2C and Fig 5F Coimmunoprecipitation of HEK293T cells stably transfected with VHL-Flag tagged construct showed association with Cul2, Rbx1, Elongin B and Elongin C; region 178-181 (LDIV) is necessary for binding Cul2 and Rbx1 and not Elongin B and C socs3-cul5-1 1 14 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig 2B Coimmunoprecipitation of HEK293T cells stably transfected with SOCS3-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C socs3-cul5-2 3 29 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 18 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey association association Fig 2c Coimmunoprecipitation of HEK293T cells stably transfected with SOCS3-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C spsb1-cul5 1 18 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 14 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey association association Fig 2c Coimmunoprecipitation of HEK293T cells stably transfected with SSB1-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C spsb1-cul5-1 3 29 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 14 unspecified role unspecified role prey prey association association Fig 2C and Fig 3D Coimmunoprecipitation of HEK293T cells stably transfected with SSB1-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C; 212LPLP215-AAAA mutation disrupted interaction with Cul5 and Rbx2 and not Elongin B or C spsb2-cul5 1 29 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig 2B Coimmunoprecipitation of HEK293T cells stably transfected with SSB2-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C spsb2-cul5-1 3 9 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig 2C Coimmunoprecipitation of HEK293T cells stably transfected with SSB2-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C rab40c-cul5 1 18 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 14 unspecified role unspecified role prey prey association association Fig 2B Coimmunoprecipitation of HEK293T cells stably transfected with RAR3-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C rab40c-cul5-1 3 19 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 18 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey direct interaction direct interaction Figs. 2C, 3B Coimmunoprecipitation of HEK293T cells stably transfected with RAR3-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C; 212LPLP215-AAAA mutation disrupted interaction with Cul5 and Rbx2 and not Elongin B or C wsb1-cul5 1 9 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 14 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey association association Fig 2B Coimmunoprecipitation of HEK293T cells stably transfected with Wsb1-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C wsb1-cul5-1 3 9 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 29 unspecified role unspecified role prey prey association association Fig 2C Coimmunoprecipitation of HEK293T cells stably transfected with Wsb1-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C lrrc41-cul5 1 14 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 18 unspecified role unspecified role prey prey association association Fig 2B Coimmunoprecipitation of HEK293T cells stably transfected with Muf1-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C lrrc41-cul5-1 3 21 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 14 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Fig 5C Coimmunoprecipitation of HEK293T cells stably transfected with Muf1-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C vhl-cul2-3 4 22 unspecified role unspecified role prey prey 26 unspecified role unspecified role prey prey 31 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association Fig 2D Lipopolysaccharide MG132 socs3-cul5 4 31 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association Fig 2D Lipopolysaccharide socs1-cul5-1 1 9 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig 3F Coimmunoprecipitation of HEK293T cells stably transfected with Socs1-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C; socs1 195IPLN198-LPLN mutation disrupt interaction with Cul5 and Rbx2 and not Elongin B or C socs1-cul5 3 18 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 29 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association Fig 3G Coimmunoprecipitation of HEK293T cells stably transfected with Socs1-Flag tagged construct showed association with Cul5, Rbx2, Elongin B and Elongin C; socs1 195IPLN198-LPLN mutation disrupt interaction with Cul5 and Rbx2 and not Elongin B or C cul2-fem1b 1 7 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 27 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait c-term C-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 14 unspecified role unspecified role prey prey association association Fig 5A Coimmunoprecipitation of HEK293T cells stably transfected with Cul2-Flag tagged ppil5-cul2 1 15 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding site binding site required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association Fig 5C, Fig 5E Coimmunoprecipitation of HEK293T cells stably transfected with LRR1-Flag tagged construct; 341HIIP344-AAAA mutation disrupt interaction with Cul2 and Rbx1 and not Elongin B or C ppil5-cul2-1 3 14 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 16 unspecified role unspecified role prey prey association association Fig 5C and Fig 5F Coimmunoprecipitation of HEK293T cells stably transfected with LRR1-Flag tagged construct; 341HIIP344-AAAA mutation disrupt interaction with Cul2 and Rbx1 and not Elongin B or C fem1b-cul2 1 27 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 18 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association Fig 5B Coimmunoprecipitation of HEK293T cells stably transfected with Fem1B-Flag tagged construct fem1b-cul2-1 3 18 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey association association Fig 5C Coimmunoprecipitation of HEK293T cells stably transfected with Fem1B-Flag tagged construct spsb4-cul5 3 9 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig 5E Coimmunoprecipitation of HEK293T cells stably transfected with SSb4-Flag tagged construct; 246-273 mutation disrupt interaction with Cul5 and Rbx2 and not Elongin B or C vhl-cul2-4 2 18 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait n-term n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig 4B vhlm1-cul5-1 2 9 unspecified role unspecified role prey prey 29 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 4B vhlm2-cul5-1 2 29 unspecified role unspecified role prey prey 30 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey association association Fig 4B