IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Wrch1 is a GTPase-deficient Cdc42-like protein with unusual binding characteristics and cellular effects. Wrch1 is a GTPase-deficient Cdc42-like protein with unusual binding characteristics and cellular effects. Exp. Cell Res. (0014-4827) 2004 imex curation Saras J., Wollberg P., Aspenstrom P. Apoptosis - Interactions involving proteins with a function related to apoptosis RHOU was loaded with radio-labelled GTP and an exchange rate measured by addition of excess cold GTP Experiment repeated using CDC42 as bait but the source of CDC42 could not be determined. pontus.aspenstrom@licr.uu.se 16-April-2008: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Saras J., Wollberg P., Aspenstrom P. Apoptosis - Interactions involving proteins with a function related to apoptosis RHOU was loaded with radio-labelled GTP and an exchange rate measured by addition of excess cold GTP Experiment repeated using CDC42 as bait but the source of CDC42 could not be determined. pontus.aspenstrom@licr.uu.se Accepted 2008-APR-18 by CDEROW. Exp. Cell Res. (0014-4827) 2004 Only protein-protein interactions imex curation Wrch1 is a GTPase-deficient Cdc42-like protein with unusual binding characteristics and cellular effects. Wrch1 is a GTPase-deficient Cdc42-like protein with unusual binding characteristics and cellular effects. Exp. Cell Res. (0014-4827) 2004 imex curation Saras J., Wollberg P., Aspenstrom P. Apoptosis - Interactions involving proteins with a function related to apoptosis RHOU was loaded with radio-labelled GTP and an exchange rate measured by addition of excess cold GTP Experiment repeated using CDC42 as bait but the source of CDC42 could not be determined. pontus.aspenstrom@licr.uu.se 16-April-2008: Contacted by JYOTI. Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Saras J., Wollberg P., Aspenstrom P. Apoptosis - Interactions involving proteins with a function related to apoptosis RHOU was loaded with radio-labelled GTP and an exchange rate measured by addition of excess cold GTP Experiment repeated using CDC42 as bait but the source of CDC42 could not be determined. pontus.aspenstrom@licr.uu.se Accepted 2008-APR-18 by CDEROW. 16-April-2008: Contacted by JYOTI. Exp. Cell Res. (0014-4827) 2004 Only protein-protein interactions imex curation Wrch1 is a GTPase-deficient Cdc42-like protein with unusual binding characteristics and cellular effects. Wrch1 is a GTPase-deficient Cdc42-like protein with unusual binding characteristics and cellular effects. Exp. Cell Res. (0014-4827) 2004 imex curation Saras J., Wollberg P., Aspenstrom P. Apoptosis - Interactions involving proteins with a function related to apoptosis RHOU was loaded with radio-labelled GTP and an exchange rate measured by addition of excess cold GTP Experiment repeated using CDC42 as bait but the source of CDC42 could not be determined. pontus.aspenstrom@licr.uu.se 16-April-2008: Contacted by JYOTI. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Saras J., Wollberg P., Aspenstrom P. Apoptosis - Interactions involving proteins with a function related to apoptosis RHOU was loaded with radio-labelled GTP and an exchange rate measured by addition of excess cold GTP Experiment repeated using CDC42 as bait but the source of CDC42 could not be determined. pontus.aspenstrom@licr.uu.se Accepted 2008-APR-18 by CDEROW. 16-April-2008: Contacted by JYOTI. Exp. Cell Res. (0014-4827) 2004 Only protein-protein interactions imex curation Wrch1 is a GTPase-deficient Cdc42-like protein with unusual binding characteristics and cellular effects. Wrch1 is a GTPase-deficient Cdc42-like protein with unusual binding characteristics and cellular effects. Exp. Cell Res. (0014-4827) 2004 imex curation Saras J., Wollberg P., Aspenstrom P. Apoptosis - Interactions involving proteins with a function related to apoptosis RHOU was loaded with radio-labelled GTP and an exchange rate measured by addition of excess cold GTP Experiment repeated using CDC42 as bait but the source of CDC42 could not be determined. pontus.aspenstrom@licr.uu.se 16-April-2008: Contacted by JYOTI. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 pull down pull down anti tag western anti tag western blot anti tag western Saras J., Wollberg P., Aspenstrom P. Apoptosis - Interactions involving proteins with a function related to apoptosis RHOU was loaded with radio-labelled GTP and an exchange rate measured by addition of excess cold GTP Experiment repeated using CDC42 as bait but the source of CDC42 could not be determined. pontus.aspenstrom@licr.uu.se Accepted 2008-APR-18 by CDEROW. 16-April-2008: Contacted by JYOTI. Exp. Cell Res. (0014-4827) 2004 Only protein-protein interactions imex curation q13153-2 Serine/threonine-protein kinase PAK 1 PAK1B PAK1 Alpha-PAK p21-activated kinase 1 p65-PAK protein protein human Homo sapiens Human MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQVRKLRFQVFSNFSMIAASIPEDCQAPLQPHSTDCCS 6A3BB134DD2A82A8 gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 rhou_human Rho-related GTP-binding protein RhoU RHOU ARHU CDC42L1 G28K WRCH1 SB128 Wnt-1 responsive Cdc42 homolog 1 Ryu GTPase CDC42-like GTPase 1 Rho GTPase-like protein ARHU GTP-binding protein-like 1 protein protein human Homo sapiens Human MPPQQGDPAFPDRCEAPPVPPRRERGGRGGRGPGEPGGRGRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTNTDIFLLCFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLCAEEIKAASYIECSALTQKNLKEVFDAAIVAGIQYSDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV D90059DE82288B97 nck2_human Cytoplasmic protein NCK2 NCK adaptor protein 2 SH2/SH3 adaptor protein NCK-beta NCK2 GRB4 Growth factor receptor-bound protein 4 protein protein human Homo sapiens Human MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKNSLKKGSLVKNLKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKFAYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFLSLRKGASLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYKKAPIFTSEHGEKLYLVRALQ 3A211085E46F4452 rhou-gtp-1 1 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction RhoU produced as a GST molecule, tag subsequently removed by thrombin cleavage. GTP is [3H]-labelled RhoU was shown to undergo a high rate of GTP exchange but had no intrinsic GTPase activity. Fig. 7 The purified, recombinantly expressed Wrch1 proteins were first loaded with [3H]-GTP. pak1-rhou-1 3 7 unspecified role unspecified role bait bait Q7L0Q8:p.Thr63Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T N Wed May 02 20:05:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr63asn' Tue Jun 30 18:32:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr63Asn' 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 8 Coprecipitation of Wrch1 with PAK1 and NCKbeta. Q7L0Q8 transfection; Q13153-2 transfection nck2-rhou-1 3 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 8 Coprecipitation of Wrch1 with PAK1 and NCKbeta. Q7L0Q8; O43639 transfection nck2-rhou-2 4 8 unspecified role unspecified role bait bait sh3 domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range sh3 domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 physical association physical association Fig. 10 Interaction between Wrch1 and individual SH3 domains of NCKbeta. nck2-rhou-3 2 7 unspecified role unspecified role neutral component neutral component region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 11 Colocalizatation of NCKbeta and Wrch1 in fibroblasts. O43639 transfection; Q7L0Q8 transfection