IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. Mol. Cell. Biol. (0270-7306) 2004 Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Data from 9C not captured as not sure which MEK/ERK wa sued - also coupled assays really beyond our scope. Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk 01-April-2008: Contacted by JYOTI. human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Data from 9C not captured as not sure which MEK/ERK wa sued - also coupled assays really beyond our scope. Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk Accepted 2008-MAR-22 by CDEROW. 01-April-2008: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2004 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. Mol. Cell. Biol. (0270-7306) 2004 Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Data from 9C not captured as not sure which MEK/ERK wa sued - also coupled assays really beyond our scope. Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk 01-April-2008: Contacted by JYOTI. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Data from 9C not captured as not sure which MEK/ERK wa sued - also coupled assays really beyond our scope. Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk Accepted 2008-MAR-22 by CDEROW. 01-April-2008: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2004 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. Mol. Cell. Biol. (0270-7306) 2004 Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Data from 9C not captured as not sure which MEK/ERK wa sued - also coupled assays really beyond our scope. Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk 01-April-2008: Contacted by JYOTI. in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Data from 9C not captured as not sure which MEK/ERK wa sued - also coupled assays really beyond our scope. Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk Accepted 2008-MAR-22 by CDEROW. 01-April-2008: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2004 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. Mol. Cell. Biol. (0270-7306) 2004 Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Data from 9C not captured as not sure which MEK/ERK wa sued - also coupled assays really beyond our scope. Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk 01-April-2008: Contacted by JYOTI. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Data from 9C not captured as not sure which MEK/ERK wa sued - also coupled assays really beyond our scope. Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk Accepted 2008-MAR-22 by CDEROW. 01-April-2008: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2004 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. Mol. Cell. Biol. (0270-7306) 2004 Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Data from 9C not captured as not sure which MEK/ERK wa sued - also coupled assays really beyond our scope. Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk 01-April-2008: Contacted by JYOTI. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Data from 9C not captured as not sure which MEK/ERK wa sued - also coupled assays really beyond our scope. Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk Accepted 2008-MAR-22 by CDEROW. 01-April-2008: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2004 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. Mol. Cell. Biol. (0270-7306) 2004 Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Data from 9C not captured as not sure which MEK/ERK wa sued - also coupled assays really beyond our scope. Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk 01-April-2008: Contacted by JYOTI. human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH pull down pull down fingerprinting peptide massfingerprinting fingerprinting Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Data from 9C not captured as not sure which MEK/ERK wa sued - also coupled assays really beyond our scope. Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk Accepted 2008-MAR-22 by CDEROW. 01-April-2008: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2004 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. Mol. Cell. Biol. (0270-7306) 2004 Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Data from 9C not captured as not sure which MEK/ERK wa sued - also coupled assays really beyond our scope. Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk 01-April-2008: Contacted by JYOTI. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Data from 9C not captured as not sure which MEK/ERK wa sued - also coupled assays really beyond our scope. Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk Accepted 2008-MAR-22 by CDEROW. 01-April-2008: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2004 ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. ABIN-2 forms a ternary complex with TPL-2 and NF-kappa B1 p105 and is essential for TPL-2 protein stability. Mol. Cell. Biol. (0270-7306) 2004 Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Data from 9C not captured as not sure which MEK/ERK wa sued - also coupled assays really beyond our scope. Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk 01-April-2008: Contacted by JYOTI. mouse-macrophage Mus musculus macrophage macrophage Macrophage anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lang V., Symons A., Watton SJ., Janzen J., Soneji Y., Beinke S., Howell S., Ley SC. Apoptosis - Interactions involving proteins with a function related to apoptosis Data from 9C not captured as not sure which MEK/ERK wa sued - also coupled assays really beyond our scope. Protein was isolated from cell lysates using an anti-HA MAb covalently linked to protein A-Sepharose beads followed by a second purification using anti-p105C antibody. Source of MEK1 taken from PMID: 7911739 sley@nimr.mrc.ac.uk Accepted 2008-MAR-22 by CDEROW. 01-April-2008: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2004 p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 5D027BB8EBCAA33A p19838-1 Nuclear factor NF-kappa-B p105 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMMSNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMATSWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQAHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGKI 2A7C8FF86A10D1A8 m3k8_mouse Mitogen-activated protein kinase kinase kinase 8 Map3k8 Cot Serine/threonine-protein kinase cot Cancer Osaka thyroid oncogene Proto-oncogene c-Cot Tpl2 Tumor progression locus 2 protein protein mouse Mus musculus Mouse MEYMSTGSDEKEEIDLLIKHLNVSEVIDIMENLYASEEPGVYEPSLMTMYPDSNQNEERSESLLRSGQEVPWLSSVRYGTVEDLLAFANHVSNMTKHFYGRRPQECGILLNMVISPQNGRYQIDSDVLLVPWKLTYRNIGSGFVPRGAFGKVYLAQDMKTKKRMACKLIPIDQFKPSDVEIQACFRHENIAELYGAVLWGDTVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHILKGLDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVKMTEDVYLPKDLRGTEIYMSPEVILCRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIAGDCSPGMRELIEAALERNPNHRPKAADLLKHEALNPPREDQPRCQSLDSALFERKRLLSRKELQLPENIADSSCTGSTEESEVLRRQRSLYIDLGALAGYFNIVRGPPTLEYG 60C2A34E530866BE tnap3_human Tumor necrosis factor alpha-induced protein 3 Putative DNA-binding protein A20 Zinc finger protein A20 TNFAIP3 OTUD7C OTU domain-containing protein 7C protein protein human Homo sapiens Human MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPKLNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCNECFQFKQMYG DIP protein P21580 original sequence version: 129 DIP protein P21580 original sequence version: 166 320AEA97F58D4491 m3k8_human Mitogen-activated protein kinase kinase kinase 8 MAP3K8 COT ESTF Serine/threonine-protein kinase cot Cancer Osaka thyroid oncogene Tumor progression locus 2 Proto-oncogene c-Cot protein protein human Homo sapiens Human MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEVPWLSSVRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGRYQIDSDVLLIPWKLTYRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVEIQACFRHENIAELYGAVLWGETVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHVLKGLDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVILCRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIADDCSPGMRELIEASLERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLSRKELELPENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG 7728969EA3E4E8EC mp2k1_rabit Dual specificity mitogen-activated protein kinase kinase 1 MAP2K1 MEK1 PRKMK1 ERK activator kinase 1 MAPK/ERK kinase 1 protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSAVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV DIP protein P29678 original sequence version: 84 0341B42FF9218D51 q00653-1 Nuclear factor NF-kappa-B p100 subunit p100 NFKB2 LYT10 DNA-binding factor KBF2 H2TF1 Lymphocyte translocation chromosome 10 protein Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 Oncogene Lyt-10 protein protein human Homo sapiens Human MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGSGGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEAAEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHLLTAQDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQTSVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEGLYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRANVNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEEPLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH DIP protein Q00653-1 original sequence version: 140 6BAD7038834783CA tnip2_human TNFAIP3-interacting protein 2 TNIP2 ABIN2 FLIP1 Fetal liver LKB1-interacting protein A20-binding inhibitor of NF-kappa-B activation 2 protein protein human Homo sapiens Human MSRDPGSGGWEEAPRAAAALCTLYHEAGQRLRRLQDQLAARDALIARLRARLAALEGDAAPSLVDALLEQVARFREQLRRQEGGAAEAQMRQEIERLTERLEEKEREMQQLLSQPQHEREKEVVLLRRSMAEGERARAASDVLCRSLANETHQLRRTLTATAHMCQHLAKCLDERQHAQRNVGERSPDQSEHTDGHTSVQSVIEKLQEENRLLKQKVTHVEDLNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQELAASRTARDAALERVQMLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAGRIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGHPGAAQRGQGDLQCPHCLQCFSDEQGEELLRHVAECCQ 0F6B049C2B3483DC p25799-1 Nuclear factor NF-kappa-B p105 subunit p105 Nfkb1 DNA-binding factor KBF1 EBP-1 NF-kappa-B1 p84/NF-kappa-B1 p98 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein mouse Mus musculus Mouse MADDDPYGTGQMFHLNTALTHSIFNAELYSPEIPLSTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGSTGSPGPGYGYSNYGFPPYGGITFHPGVTKSNAGVTHGTINTKFKNGPKDCAKSDDEESLTLPEKETEGEGPSLPMACTKTEPIALASTMEDKEQDMGFQDNLFLEKALQLARRHANALFDYAVTGDVKMLLAVQRHLTAVQDENGDSVLHLAIIHLHAQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVEDLLRVGADLSLLDRWGNSVLHLAAKEGHDRILSILLKSRKAAPLIDHPNGEGLNAIHIAVMSNSLPCLLLLVAAGAEVNAQEQKSGRTALHLAVEYDNISLAGCLLLEGDAHVDSTTYDGTTPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWEKAGEDEGVVPGTTPLDMAANWQVFDILNGKPYEPVFTSDDILPQGDMKQLTEDTRLQLCKLLEIPDPDKNWATLAQKLGLGILNNAFRLSPAPSKTLMDNYEVSGGTIKELMEALQQMGYTEAIEVIQAAFRTPATTASSPVTTAQVHCLPLSSSSTRQHIDELRDSDSVCDSGVETSFRKLSFTESLTGDSPLLSLNKMPHGYGQEGPIEGKI DIP protein P25799-1 original sequence version: 125 DIP protein P25799 original sequence version: 135 DIP protein P25799 original sequence version: 126 DIP protein P25799 original sequence version: 145 DIP protein P25799 original sequence version: 149 91EA9C595E375C30 tnip2_mouse TNFAIP3-interacting protein 2 Tnip2 Abin2 A20-binding inhibitor of NF-kappa-B activation 2 protein protein mouse Mus musculus Mouse MSSGDPRSGRQDGAPRAAAALCGLYHEAGQQLQRLKDQLAARDALIASLRTRLAALEGHTAPSLVDALLDQVERFREQLRRQEEGASETQLRQEVERLTERLEEKEREMQQLMSQPQHEQEKEVVLLRRSVAEKEKARAASDVLCRSLADETHQLRRTLAATAHMCQHLAKCLDERQCAQGDAGEKSPAELEQTSSDASGQSVIKKLQEENRLLKQKVTHVEDLNAKWQRYDASRDEYVKGLHAQLKRRQVPLEPELMKKEISRLNRQLEEKISDCAEANQELTAMRMSRDTALERVQMLEQQILAYKDDFKSERADRERAHSRIQELEEKIMSLMYQVSQRQDSREPGPCRIHTGNKTAKYLEMDALEHVTPGGWRPESRSQQMEPSAEGGHVCTAQRGQGDLQCPHCLRCFSDEQGEAFLRHLSECCQ 35F533967072512D nfkb1-tnip2-1 6 16 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait P19838-1:p.Ser927Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:26:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser927ala' Tue Jun 30 17:21:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser927Ala' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 1 nfkb1-tnip2-2 1 10 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey association association Fig. 1C nfkb1-tnip2-3 1 13 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association Fig. 1C nfkb1-tnip2-4 1 16 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association Fig. 1C nfkb1-tnip2-5 4 16 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2A and 2C the level of ABIN-2-FL which coimmunoprecipitated with HA-p105 (Fig. 2C). Removal of endogenous MAP3K8 from 293 cell lysates did not reduce the level of TNIP2 which coimmunoprecipitated with NFKB1/p105 map3k8-tnip2-6 4 13 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 2B and 2D Immunodepletion of endogenous p105 with anti-p105C antibody did not alter binding of TNIP2 to MAP3K8 binding of ABIN-2-FL to Myc-TPL-2 (Fig. 2D). nfkb1-tnip2-6 7 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) association association Fig. 3C These data indicate that GST-ABIN-2 preferentially forms a ternary complex with HA-p105 and TPL-2. map3k8-tnip2-7 7 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 13 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Fig. 3C When expressed individually, GST-ABIN-2 interacted with TPL-2 nfkb1-tnip2-8 8 11 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait association association Immunoprecipitation and Western blot analysis confirmed that both p105 and TPL-2 copurified with ABIN-2 in these cells (Fig. 4A). Fig. 4A TNIP2 immunodepletion removed the majority of MAP3K8 detected directly in cell lysates or after reimmunoprecipitation with anti-TNIP2 or anti-NFKB1/p105 antibodies. Immunodepletion of p105 using anti-NFKB1/p105C antibody also removed a substantial fraction of TNIP2 and cleared MAP3K8 from lysates. nfkb1-tnip2-9 7 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P19838-1:p.Leu841Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 14:52:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu841ala' Tue Jun 30 19:27:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu841Ala' death domain required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association Fig. 5A, 5B To analyze the interaction of p105 with ABIN-2, 293 cells were transiently transfected with vectors encoding a panel of deletion and point mutants of HA-p105 (Fig. 5A) Cell lysates were prepared using 1% Brij 58 buffer A - interaction not observed when milder conditions were used. Optimal association also requires the PEST region (893-968) and, to a lesser extent, NFKB1/p105 residues 497 to 538 nfkb1-tnip2-10 5 16 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Fig. 5C A pulldown experiment with GST-p105497-968 protein (2) confirmed that the isolated C-terminal half of p105 was sufficient for binding to ABIN-2-FL (Fig. 5C). map3k8-tnip2-8 2 13 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association Fig. 5D Pulldown assays revealed that the TPL-2 C terminus was required for interaction with GST-ABIN-21-429 (Fig. 5D). map3k8-tnip2-9 7 16 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 13 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 5E A pulldown assay with biotinylated TPL-2398-467 peptide (2) coupled to streptavidin-agarose beads demonstrated that the isolated TPL-2 C terminus is sufficient for binding to ABIN-2-FL (Fig. 5E). nfkb1-tnip2-11 2 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Fig. 6A, 6B, 6C Mapping regions of ABIN-2 which interact with p105 map3k8-tnip2-10 2 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 13 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Fig. 6A, 6B, 6C Pulldown experiments revealed that Myc-TPL-2 bound to a region containing amino acids 194 to 250 of ABIN-2 (Fig. 6C). tnfaip3-tnip2-1 2 12 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association Fig. 6A, 6B In contrast, Myc-A20 interacted with GST-ABIN-2251-429 but not GST-ABIN-21-250 (Fig. 6B), map2k1-map3k8-1 3 13 enzyme enzyme neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 14 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P29678:p.Lys205Ala mutation mutation certain certain sequence position certain certain certain sequence position certain K A Wed May 02 19:53:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys205ala' Tue Jun 30 19:59:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys205Ala' ecobb Escherichia coli (strain B / BL21) phosphorylation phosphorylation reaction phosphorylation Phosphorylation of MAP2K1 The MEK kinase activity of immunoprecipitated Myc-TPL-2 was determined using GST-MEK1(K207A) protein as a substrate. Fig. 9E Mutated lysine in MAP2K1 is at position 205 in the rabbit sequence, not 207 as given in the paper.