IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The PIDDosome, a protein complex implicated in activation of caspase-2 in response to genotoxic stress. The PIDDosome, a protein complex implicated in activation of caspase-2 in response to genotoxic stress. Science (0036-8075) 2004 Tinel A., Tschopp J. Apoptosis - Interactions involving proteins with a function related to apoptosis human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tinel A., Tschopp J. Apoptosis - Interactions involving proteins with a function related to apoptosis Science (0036-8075) 2004 The PIDDosome, a protein complex implicated in activation of caspase-2 in response to genotoxic stress. The PIDDosome, a protein complex implicated in activation of caspase-2 in response to genotoxic stress. Science (0036-8075) 2004 Tinel A., Tschopp J. Apoptosis - Interactions involving proteins with a function related to apoptosis human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Tinel A., Tschopp J. Apoptosis - Interactions involving proteins with a function related to apoptosis size-exlusion chromatography of Hela cells cytoplasmic extracts Science (0036-8075) 2004 The PIDDosome, a protein complex implicated in activation of caspase-2 in response to genotoxic stress. The PIDDosome, a protein complex implicated in activation of caspase-2 in response to genotoxic stress. Science (0036-8075) 2004 Tinel A., Tschopp J. Apoptosis - Interactions involving proteins with a function related to apoptosis human-jurkat Homo sapiens jurkat Human T cell leukemia affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Tinel A., Tschopp J. Apoptosis - Interactions involving proteins with a function related to apoptosis Biotin-VAD-fmk can immunoprecipitates active caspases using streptavidin beads. Under the conditions used, it was shown the only caspase immunoprecipitated was caspase 2 Science (0036-8075) 2004 pidd1_human p53-induced death domain-containing protein 1 PIDD1 LRDD Leucine-rich repeat and death domain-containing protein PIDD protein protein human Homo sapiens Human MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQLLQVEFLRLSTHEDPQLLEATLAQLPQSLSCLRSLVLKGGQRRDTLGACLRGALTNLPAGLSGLAHLAHLDLSFNSLETLPACVLQMRGLGALLLSHNCLSELPEALGALPALTFLTVTHNRLQTLPPALGALSTLQRLDLSQNLLDTLPPEIGGLGSLLELNLASNRLQSLPASLAGLRSLRLLVLHSNLLASVPADLARLPLLTRLDLRDNQLRDLPPELLDAPFVRLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLACGVRLQFPAGATATPITIRYRLLLPEPGLVPLGPHDALLSHVLELQPHGVAFQQDVGLWLLFTPPQARRCREVVVRTRNDNSWGDLETYLEEEAPQRLWAHCQVPHFSWFLVVSRPVSNACLVPPEGTLLCSSGHPGVKVIFPPGATEEPRRVSMQVVRMAGRELQALLGEPEAAVSPLLCLSQSGPPSFLQPVTVQLPLPSGITGLSLDRSRLHLLYWAPPAATWDDITAQVVLELTHLYARFQVTHFSWYWLWYTTKNCVGGLARKAWERLRLHRVNLIALQRRRDPEQVLLQCLPRNKVDATLRRLLERYRGPEPSDTVEMFEGEEFFAAFERGIDVDADRPDCVEGRICFVFYSHLKNVKEVYVTTTLDREAQAVRGQVSFYRGAVPVRVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGPRRGAGLSLAPLNLGDAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHMLFSWAERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLAPKDPALPGSSAPQPPEPAQA 8C98FC64230B57F8 casp2_human Caspase-2 Protease ICH-1 Neural precursor cell expressed developmentally down-regulated protein 2 CASP2 ICH1 NEDD2 protein protein human Homo sapiens Human MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT 6EF0ED05EF808385 cradd_human Death domain-containing protein CRADD Caspase and RIP adapter with death domain RIP-associated protein with a death domain CRADD RAIDD protein protein human Homo sapiens Human MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE 3437CC612C85E402 casp2-cradd-1 1 6 unspecified role unspecified role prey prey n-terminal vsv tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined card domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Both proteins are overexpressed lrdd-cradd-1 1 6 unspecified role unspecified role prey prey n-terminal vsv tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range death domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association casp2-cradd-3 1 5 unspecified role unspecified role bait bait card domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey n-terminal vsv tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey n-terminal vsv tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association All proteins are overexpressed PIDD is co-immunoprecipitated with caspase 2 only if RAIDD is overexpressed casp2-cradd-4 3 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey n-terminal vsv tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey n-terminal vsv tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association all proteins are endogenous casp2-cradd-5 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association immuoprecipitated caspase 2 can be found in several form: pro-caspase-2, p31, p19 casp2-cradd-6 2 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component physical association physical association caspase 2 and RAIDD co-eluted in fraction coorresponding to a molecular mass of 670 kDa