IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ YSK1 is activated by the Golgi matrix protein GM130 and plays a role in cell migration through its substrate 14-3-3zeta. YSK1 is activated by the Golgi matrix protein GM130 and plays a role in cell migration through its substrate 14-3-3zeta. J. Cell Biol. (0021-9525) 2004 Preisinger C., Short B., De Corte V., Bruyneel E., Haas A., Kopajtich R., Gettemans J., Barr FA. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - human testis cDNA 2A barr@biochem.mpg.de in vitro In vitro protein kinase assay protein kinase assay fingerprinting peptide massfingerprinting fingerprinting Preisinger C., Short B., De Corte V., Bruyneel E., Haas A., Kopajtich R., Gettemans J., Barr FA. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - human testis cDNA 2A barr@biochem.mpg.de J. Cell Biol. (0021-9525) 2004 YSK1 is activated by the Golgi matrix protein GM130 and plays a role in cell migration through its substrate 14-3-3zeta. YSK1 is activated by the Golgi matrix protein GM130 and plays a role in cell migration through its substrate 14-3-3zeta. J. Cell Biol. (0021-9525) 2004 Preisinger C., Short B., De Corte V., Bruyneel E., Haas A., Kopajtich R., Gettemans J., Barr FA. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - human testis cDNA 2A barr@biochem.mpg.de yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Preisinger C., Short B., De Corte V., Bruyneel E., Haas A., Kopajtich R., Gettemans J., Barr FA. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - human testis cDNA 2A barr@biochem.mpg.de J. Cell Biol. (0021-9525) 2004 YSK1 is activated by the Golgi matrix protein GM130 and plays a role in cell migration through its substrate 14-3-3zeta. YSK1 is activated by the Golgi matrix protein GM130 and plays a role in cell migration through its substrate 14-3-3zeta. J. Cell Biol. (0021-9525) 2004 Preisinger C., Short B., De Corte V., Bruyneel E., Haas A., Kopajtich R., Gettemans J., Barr FA. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - human testis cDNA 2A barr@biochem.mpg.de in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Preisinger C., Short B., De Corte V., Bruyneel E., Haas A., Kopajtich R., Gettemans J., Barr FA. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - human testis cDNA 2A barr@biochem.mpg.de J. Cell Biol. (0021-9525) 2004 YSK1 is activated by the Golgi matrix protein GM130 and plays a role in cell migration through its substrate 14-3-3zeta. YSK1 is activated by the Golgi matrix protein GM130 and plays a role in cell migration through its substrate 14-3-3zeta. J. Cell Biol. (0021-9525) 2004 Preisinger C., Short B., De Corte V., Bruyneel E., Haas A., Kopajtich R., Gettemans J., Barr FA. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - human testis cDNA 2A barr@biochem.mpg.de in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Preisinger C., Short B., De Corte V., Bruyneel E., Haas A., Kopajtich R., Gettemans J., Barr FA. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - human testis cDNA Library - human testis cDNA 2A barr@biochem.mpg.de J. Cell Biol. (0021-9525) 2004 YSK1 is activated by the Golgi matrix protein GM130 and plays a role in cell migration through its substrate 14-3-3zeta. YSK1 is activated by the Golgi matrix protein GM130 and plays a role in cell migration through its substrate 14-3-3zeta. J. Cell Biol. (0021-9525) 2004 Preisinger C., Short B., De Corte V., Bruyneel E., Haas A., Kopajtich R., Gettemans J., Barr FA. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - human testis cDNA 2A barr@biochem.mpg.de yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Preisinger C., Short B., De Corte V., Bruyneel E., Haas A., Kopajtich R., Gettemans J., Barr FA. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - human testis cDNA 2A barr@biochem.mpg.de J. Cell Biol. (0021-9525) 2004 YSK1 is activated by the Golgi matrix protein GM130 and plays a role in cell migration through its substrate 14-3-3zeta. YSK1 is activated by the Golgi matrix protein GM130 and plays a role in cell migration through its substrate 14-3-3zeta. J. Cell Biol. (0021-9525) 2004 Preisinger C., Short B., De Corte V., Bruyneel E., Haas A., Kopajtich R., Gettemans J., Barr FA. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - human testis cDNA 2A barr@biochem.mpg.de human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Preisinger C., Short B., De Corte V., Bruyneel E., Haas A., Kopajtich R., Gettemans J., Barr FA. Apoptosis - Interactions involving proteins with a function related to apoptosis Library - human testis cDNA 2A barr@biochem.mpg.de J. Cell Biol. (0021-9525) 2004 goga2_rat Golgin subfamily A member 2 Golga2 130 kDa cis-Golgi matrix protein protein protein rat Rattus norvegicus (Rat) Rat MWPPRFPPPRPGMSEETRQSKLAAAKKKLREYQQKNSPGVPAGAKKKKKIKNGHSPERTSASDCQSAENVPTDHTAPAPPSTAAATMFLGVVPSPDADLIQSHDAGNCSNLMEETKTFSSTESLRQLSQQLNGLVSESTSYINGEGLTSSNMKELESRYQELAVALDSSYVTNKQLSSTIEELKQQNQDTLDQLEKEKKDYQQKLAKEQGALREQLQVHIQTIGILVSEKAELQTALAHTQQAARQKAGESEDLASRLQSSRQRVGELERTLSTVSTQQKQADRYNKDLTKERDALKLELYKNGKSNEDLRQQNSELEEKLRVLVAEKAAAQLGAEELQKKLEMSELLLQQFSSQSEASGSNEQLQQAMEERAQLESHVGQLMESLKQLQVERDQYAENLKGESAMWQQRVQQMAEQVHALKEEKEQRESQVQELEASLAELRSQMEEPPPPEPPTGPSEAEERLQGEVEQLQKELEGLTGQLRAQVQDNESLSHLNREQEGRLLELEREAQHWSEQAEERKQILESMQSDRTTISRALSQNRELKEQLAELQNGFVRLTNENMEITSALQSEQHVKKELARKLGELQERLGELKETVELKSQEAQGLQEQRDQCLSHLQQYAAAYQQHLTAYEQLTSEKEALHKQLLLQTQLMDQLQHEEVQGKMAAEMARQELQEAQERLKASSQENQQLQAQLSLLVLPGEDMDQEEQDEEVPQPSLTIPEDLVSREAMVAFCNAAIARAEEEQARLRVQLREQKARCRSLAHLAAPVQSKLEKEAVVPRDMGDSVSEESNQALHVAMEKLQNRFLEVMQEKVELKERVEELEHCCIQLSGETDTIGEYIALYQNQRAVLKARHLEKEEYISRLAQDKEEMKVKLLELQELVLRLVNERNEWQGKFLAVSQNPADVPAPVPTGSQEFGAADQQGDLREVSLADDTEPAQGEAGVPAPQENPTAQQIMQLLREIQNPQERPGLGSNPCIPFFYRADENDEVKIMVI 3AA8CBC61F98A6A4 stk26_human Serine/threonine-protein kinase 26 STK26 MASK MST3 and SOK1-related kinase MST4 Mammalian STE20-like protein kinase 4 Serine/threonine-protein kinase MASK protein protein human Homo sapiens Human MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP 3E31B7E3CBDA5768 goga2_human Golgin subfamily A member 2 GOLGA2 130 kDa cis-Golgi matrix protein GM130 autoantigen Golgin-95 protein protein human Homo sapiens Human MWPQPRLPPRPAMSEETRQSKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTTSGGCHSPEDTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLKDLESRYQQLAVALDSSYVTNKQLNITIEKLKQQNQEITDQLEEEKKECHQKQGALREQLQVHIQTIGILVSEKAELQTALAHTQHAARQKEGESEDLASRLQYSRRRVGELERALSAVSTQQKKADRYNKELTKERDALRLELYKNTQSNEDLKQEKSELEEKLRVLVTEKAGMQLNLEELQKKLEMTELLLQQFSSRCEAPDANQQLQQAMEERAQLEAHLGQVMESVRQLQMERDKYAENLKGESAMWRQRMQQMSEQVHTLREEKECSMSRVQELETSLAELRNQMAEPPPPEPPAGPSEVEQQLQAEAEHLRKELEGLAGQLQAQVQDNEGLSRLNREQEERLLELERAAELWGEQAEARRQILETMQNDRTTISRALSQNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEVLHNQLLLQTQLVDQLQQQEAQGKAVAEMARQELQETQERLEAATQQNQQLRAQLSLMAHPGEGDGLDREEEEDEEEEEEEAVAVPQPMPSIPEDLESREAMVAFFNSAVASAEEEQARLRGQLKEQRVRCRRLAHLLASAQKEPEAAAPAPGTGGDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKEEYISRLAQDKEEMKVKLLELQELVLRLVGDRNEWHGRFLAAAQNPADEPTSGAPAPQELGAANQQGDLCEVSLAGSVEPAQGEAREGSPRDNPTAQQIMQLLREMQNPRERPGLGSNPCIPFFYRADENDEVKITVI BD067145C5092237 stk25_human Serine/threonine-protein kinase 25 STK25 SOK1 YSK1 Sterile 20/oxidant stress-response kinase 1 Ste20-like kinase protein protein human Homo sapiens Human MAHLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR DIP protein O00506 original sequence version: 135 183CE5700FCEA716 1433z_human 14-3-3 protein zeta/delta YWHAZ Protein kinase C inhibitor protein 1 protein protein human Homo sapiens Human MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63104 original sequence version: 144 D464DF2286BBFE60 stk25-golga2-2 2 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association stk25-golga2-1 5 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association stk25-golga2-3 5 9 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey physical association physical association stk25-golga2-4 3 10 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-618354]The shifted ranges (87-283) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-618354]87-283 [EBI-618354]Q62839,3 region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) physical association physical association mst4-golga2-1 5 9 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association mst4-golga2-2 3 8 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-618371]The shifted ranges (87-283) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-618371]87-283 [EBI-618371]Q62839,3 ecobb Escherichia coli (strain B / BL21) physical association physical association stk25-stk25-1 1 10 self self unspecified role unspecified role phosphorylation phosphorylation reaction phosphorylation Autophosphorylation probably trans- since STK25 forms a homodimer Autophosphorylation on Thr-174 Requires binding to the C-terminal domain of GOLGA2. This protein may act to stabilize homodimer formation stk25-ywhaz -1 1 10 enzyme enzyme unspecified role unspecified role spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 11 enzyme target enzyme target substrate substrate unspecified role unspecified role human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 phosphorylation phosphorylation reaction phosphorylation Phosphorylation of Ser-58 of YWHAZ stk25-ywhaz -2 4 10 enzyme enzyme unspecified role unspecified role spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 11 enzyme target enzyme target substrate substrate unspecified role unspecified role human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 phosphorylation phosphorylation reaction phosphorylation Phosphorylation of Ser-58 of YWHAZ mst4-golga2-3 6 9 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization