UniProt UniProt http://www.uniprot.org Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. Cell Death Differ. (1350-9047) 2004 mimix curation Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp 15-Nov-2012: Contacted by pporras. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. Cell Death Differ. (1350-9047) 2004 mimix curation Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. Cell Death Differ. (1350-9047) 2004 mimix curation Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp 15-Nov-2012: Contacted by pporras. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. Cell Death Differ. (1350-9047) 2004 mimix curation Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. Cell Death Differ. (1350-9047) 2004 mimix curation Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp 15-Nov-2012: Contacted by pporras. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. Cell Death Differ. (1350-9047) 2004 mimix curation Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. Cell Death Differ. (1350-9047) 2004 mimix curation Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp 15-Nov-2012: Contacted by pporras. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. Cell Death Differ. (1350-9047) 2004 mimix curation Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. Cell Death Differ. (1350-9047) 2004 mimix curation Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp 15-Nov-2012: Contacted by pporras. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. Cell Death Differ. (1350-9047) 2004 mimix curation Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. Cell Death Differ. (1350-9047) 2004 mimix curation Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp 15-Nov-2012: Contacted by pporras. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. Cell Death Differ. (1350-9047) 2004 mimix curation Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. Physical and functional interaction between BH3-only protein Hrk and mitochondrial pore-forming protein p32. Cell Death Differ. (1350-9047) 2004 mimix curation Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp 15-Nov-2012: Contacted by pporras. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sunayama J., Ando Y., Itoh N., Tomiyama A., Sakurada K., Sugiyama A., Kang D., Tashiro F., Gotoh Y., Kuchino Y., Kitanaka C. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of HRK according pmid 9130713. ckitanak@ncc.go.jp Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. Human placental cDNA library Cell Death Differ. (1350-9047) 2004 mimix curation c1qbp_chlae Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP Globular head receptor of C1 complement protein Mitochondrial matrix protein p32 protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey MLPLLRCVPRVLGSAVPSLRAAAPASPFRQLLTPGPRLCARPFGLLSVRAGSERRPGLLRPRGPCACGCGCGLLHTEGDKAFVDFLNDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLMRKVAGEKITVTFNINNSIPPTFDGEEEPTQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSSGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYISFLEDLKSFVKSQ 67526590A80F5177 q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein Q07820 original sequence version: 85 DIP protein Q07820 original sequence version: 89 DIP protein Q07820 original sequence version: 113 DIP protein Q07820 original sequence version: 168 DIP protein Q07820-1 original sequence version: 113 D85821AC59275F1F hrk_human Activator of apoptosis harakiri Neuronal death protein DP5 BH3-interacting domain-containing protein 3 HRK BID3 protein protein human Homo sapiens Human MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL 22E45FA2B0B7AA00 q64373-1 Bcl-2-like protein 1 Bcl2l1 Bcl2l Bclx Apoptosis regulator Bcl-X Bcl-xL protein protein mouse Mus musculus Mouse MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK 24D2AC79887E072E c1qbp_human Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP GC1QBP HABP1 SF2P32 Glycoprotein gC1qBP Hyaluronan-binding protein 1 Mitochondrial matrix protein p32 p33 ASF/SF2-associated protein p32 gC1q-R protein protein protein human Homo sapiens Human MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ DIP protein Q07021 original sequence version: 129 DIP protein Q07021 original sequence version: 156 2F747FA73BB1314B hrk-c1qbp 7 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association no figure hrk-c1qbp-1 5 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 1 hrk-c1qbp-2 3 11 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 2a c1qbp-hrk 4 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 2b and 3c hrk-c1qbp-3 6 11 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 2c hrk-c1qbp-5 1 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 2d hrk-c1qbp-6 4 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 4b bcl2l1-c1qbp 4 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 2b, 3c c1qbp-hrk-1 2 11 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component colocalization colocalization 5c hrk-c1qbp-7 7 11 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association no figure hrk-bcl2l1 7 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association no figure