IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ High-throughput methods to detect dimerization of Bcl-2 family proteins. High-throughput methods to detect dimerization of Bcl-2 family proteins. Anal. Biochem. (0003-2697) 2003 Whitfield J., Harada K., Bardelle C., Staddon JM. Apoptosis - Interactions involving proteins with a function related to apoptosis 35S-streptavidin binds to the biotin, and His6-Bcl binds to Cu2+-chelated beads. The proximity of radiolabel to the scintillant causes light emission, therefore indicating heterodimerization. 3 & 4 in vitro In vitro spa scintillation proximity assay SPA RIA Radio Immuno Assay spa predetermined predetermined participant predetermined Whitfield J., Harada K., Bardelle C., Staddon JM. Apoptosis - Interactions involving proteins with a function related to apoptosis 35S-streptavidin binds to the biotin, and His6-Bcl binds to Cu2+-chelated beads. The proximity of radiolabel to the scintillant causes light emission, therefore indicating heterodimerization. 3 & 4 Annotation to indicate that this entry has been checked and accepted by a senior curator. Anal. Biochem. (0003-2697) 2003 High-throughput methods to detect dimerization of Bcl-2 family proteins. High-throughput methods to detect dimerization of Bcl-2 family proteins. Anal. Biochem. (0003-2697) 2003 Whitfield J., Harada K., Bardelle C., Staddon JM. Apoptosis - Interactions involving proteins with a function related to apoptosis 35S-streptavidin binds to the biotin, and His6-Bcl binds to Cu2+-chelated beads. The proximity of radiolabel to the scintillant causes light emission, therefore indicating heterodimerization. 3 & 4 in vitro In vitro htrf homogeneous time resolved fluorescence homogeneous time-resolved fluorescence htrf predetermined predetermined participant predetermined Whitfield J., Harada K., Bardelle C., Staddon JM. Apoptosis - Interactions involving proteins with a function related to apoptosis 35S-streptavidin binds to the biotin, and His6-Bcl binds to Cu2+-chelated beads. The proximity of radiolabel to the scintillant causes light emission, therefore indicating heterodimerization. 3 & 4 Annotation to indicate that this entry has been checked and accepted by a senior curator. Anal. Biochem. (0003-2697) 2003 b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH DIP protein O43521 original sequence version: 48 DIP protein O43521-1 original sequence version: 71 DIP protein O43521 original sequence version: 132 DIP protein O43521 original sequence version: 143 D75735E469CA6997 hrk_human Activator of apoptosis harakiri Neuronal death protein DP5 BH3-interacting domain-containing protein 3 HRK BID3 protein protein human Homo sapiens Human MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL 22E45FA2B0B7AA00 q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS DIP protein Q16611 original sequence version: 74 DIP protein Q16611 original sequence version: 162 DIP protein Q16611 original sequence version: 97 DIP protein Q16611 original sequence version: 158 DIP protein Q16611 original sequence version: 151 DIP protein Q16611-1 original sequence version: 178 DIP protein Q16611-1 original sequence version: 180 DIP protein Q16611 original sequence version: 121 A2200FE72A46D04E bclxl-bak-1 1 5 unspecified role unspecified role bait bait n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 10 12 physical association physical association By HRK or BIM, which bind to BCL-XL incompetition to HRK bclxl-bim-1 1 3 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 5 unspecified role unspecified role bait bait n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 16 20 physical association physical association bclxl-hrk-1 1 4 unspecified role unspecified role prey prey n-terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 5 unspecified role unspecified role bait bait n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 27 24 physical association physical association By BAK or BIM, which bind to BCL-XL incompetition to HRK bclxl-bak-2 2 5 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role fluorescence donor fluorescence donor region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro physical association physical association bclxl-bim-2 2 3 unspecified role unspecified role fluorescence donor fluorescence donor n-terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 5 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Change roles to BIM donor, BCLXL acceptor once CVs updated