IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Apoptosis-associated tyrosine kinase is a Cdk5 activator p35 binding protein. Apoptosis-associated tyrosine kinase is a Cdk5 activator p35 binding protein. Biochem. Biophys. Res. Commun. (0006-291X) 2003 imex curation Honma N., Asada A., Takeshita S., Enomoto M., Yamakawa E., Tsutsumi K., Saito T., Satoh T., Itoh H., Kaziro Y., Kishimoto T., Hisanaga S. Apoptosis - Interactions involving proteins with a function related to apoptosis hisanaga-shinichi@c.metro-u.ac.jp 14-Nov-2008: Contacted by JYOTI. Foetal and adult human brain cDNA davet Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Honma N., Asada A., Takeshita S., Enomoto M., Yamakawa E., Tsutsumi K., Saito T., Satoh T., Itoh H., Kaziro Y., Kishimoto T., Hisanaga S. Apoptosis - Interactions involving proteins with a function related to apoptosis hisanaga-shinichi@c.metro-u.ac.jp Accepted 2008-NOV-10 by DAVET. 14-Nov-2008: Contacted by JYOTI. Foetal and adult human brain cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2003 davet Only protein-protein interactions imex curation Apoptosis-associated tyrosine kinase is a Cdk5 activator p35 binding protein. Apoptosis-associated tyrosine kinase is a Cdk5 activator p35 binding protein. Biochem. Biophys. Res. Commun. (0006-291X) 2003 imex curation Honma N., Asada A., Takeshita S., Enomoto M., Yamakawa E., Tsutsumi K., Saito T., Satoh T., Itoh H., Kaziro Y., Kishimoto T., Hisanaga S. Apoptosis - Interactions involving proteins with a function related to apoptosis hisanaga-shinichi@c.metro-u.ac.jp 14-Nov-2008: Contacted by JYOTI. Foetal and adult human brain cDNA davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Honma N., Asada A., Takeshita S., Enomoto M., Yamakawa E., Tsutsumi K., Saito T., Satoh T., Itoh H., Kaziro Y., Kishimoto T., Hisanaga S. Apoptosis - Interactions involving proteins with a function related to apoptosis hisanaga-shinichi@c.metro-u.ac.jp Accepted 2008-NOV-10 by DAVET. Foetal and adult human brain cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2003 davet Only protein-protein interactions imex curation Apoptosis-associated tyrosine kinase is a Cdk5 activator p35 binding protein. Apoptosis-associated tyrosine kinase is a Cdk5 activator p35 binding protein. Biochem. Biophys. Res. Commun. (0006-291X) 2003 imex curation Honma N., Asada A., Takeshita S., Enomoto M., Yamakawa E., Tsutsumi K., Saito T., Satoh T., Itoh H., Kaziro Y., Kishimoto T., Hisanaga S. Apoptosis - Interactions involving proteins with a function related to apoptosis hisanaga-shinichi@c.metro-u.ac.jp 14-Nov-2008: Contacted by JYOTI. Foetal and adult human brain cDNA davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Honma N., Asada A., Takeshita S., Enomoto M., Yamakawa E., Tsutsumi K., Saito T., Satoh T., Itoh H., Kaziro Y., Kishimoto T., Hisanaga S. Apoptosis - Interactions involving proteins with a function related to apoptosis hisanaga-shinichi@c.metro-u.ac.jp Accepted 2008-NOV-10 by DAVET. 14-Nov-2008: Contacted by JYOTI. Foetal and adult human brain cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2003 davet Only protein-protein interactions imex curation Apoptosis-associated tyrosine kinase is a Cdk5 activator p35 binding protein. Apoptosis-associated tyrosine kinase is a Cdk5 activator p35 binding protein. Biochem. Biophys. Res. Commun. (0006-291X) 2003 imex curation Honma N., Asada A., Takeshita S., Enomoto M., Yamakawa E., Tsutsumi K., Saito T., Satoh T., Itoh H., Kaziro Y., Kishimoto T., Hisanaga S. Apoptosis - Interactions involving proteins with a function related to apoptosis hisanaga-shinichi@c.metro-u.ac.jp 14-Nov-2008: Contacted by JYOTI. Foetal and adult human brain cDNA davet Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Honma N., Asada A., Takeshita S., Enomoto M., Yamakawa E., Tsutsumi K., Saito T., Satoh T., Itoh H., Kaziro Y., Kishimoto T., Hisanaga S. Apoptosis - Interactions involving proteins with a function related to apoptosis hisanaga-shinichi@c.metro-u.ac.jp Accepted 2008-NOV-10 by DAVET. 14-Nov-2008: Contacted by JYOTI. Foetal and adult human brain cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2003 davet Only protein-protein interactions imex curation Apoptosis-associated tyrosine kinase is a Cdk5 activator p35 binding protein. Apoptosis-associated tyrosine kinase is a Cdk5 activator p35 binding protein. Biochem. Biophys. Res. Commun. (0006-291X) 2003 imex curation Honma N., Asada A., Takeshita S., Enomoto M., Yamakawa E., Tsutsumi K., Saito T., Satoh T., Itoh H., Kaziro Y., Kishimoto T., Hisanaga S. Apoptosis - Interactions involving proteins with a function related to apoptosis hisanaga-shinichi@c.metro-u.ac.jp 14-Nov-2008: Contacted by JYOTI. Foetal and adult human brain cDNA davet Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Honma N., Asada A., Takeshita S., Enomoto M., Yamakawa E., Tsutsumi K., Saito T., Satoh T., Itoh H., Kaziro Y., Kishimoto T., Hisanaga S. Apoptosis - Interactions involving proteins with a function related to apoptosis hisanaga-shinichi@c.metro-u.ac.jp Accepted 2008-NOV-10 by DAVET. 14-Nov-2008: Contacted by JYOTI. Foetal and adult human brain cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2003 davet Only protein-protein interactions imex curation cd5r1_rat Cyclin-dependent kinase 5 activator 1 Cdk5r1 Cdk5r Cyclin-dependent kinase 5 regulatory subunit 1 TPKII regulatory subunit protein protein rat Rattus norvegicus (Rat) Rat MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKAQPNSSYQSNIAHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGVSSSVKKAPHPAITSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR DIP protein P61810 original sequence version: 31 165AA0747410B0C0 q6zmq8-1 Serine/threonine-protein kinase LMTK1 AATK AATYK KIAA0641 LMR1 LMTK1 Apoptosis-associated tyrosine kinase Brain apoptosis-associated tyrosine kinase CDK5-binding protein Lemur tyrosine kinase 1 p35-binding protein protein protein human Homo sapiens Human MSSSFFNPSFAFSSHFDPDGAPLSELSWPSSLAVVAVSFSGLFAVIVLMLACLCCKKGGIGFKEFENAEGDEYAADLAQGSPATAAQNGPDVYVLPLTEVSLPMAKQPGRSVQLLKSTDVGRHSLLYLKEIGRGWFGKVFLGEVNSGISSAQVVVKELQASASVQEQMQFLEEVQPYRALKHSNLLQCLAQCAEVTPYLLVMEFCPLGDLKGYLRSCRVAESMAPDPRTLQRMACEVACGVLHLHRNNFVHSDLALRNCLLTADLTVKIGDYGLAHCKYREDYFVTADQLWVPLRWIAPELVDEVHSNLLVVDQTKSGNVWSLGVTIWELFELGTQPYPQHSDQQVLAYTVREQQLKLPKPQLQLTLSDRWYEVMQFCWLQPEQRPTAEEVHLLLSYLCAKGATEAEEEFERRWRSLRPGGGGVGPGPGAAGPMLGGVVELAAASSFPLLEQFAGDGFHADGDDVLTVTETSRGLNFEYKWEAGRGAEAFPATLSPGRTARLQELCAPDGAPPGVVPVLSAHSPSLGSEYFIRLEEAAPAAGHDPDCAGCAPSPPATADQDDDSDGSTAASLAMEPLLGHGPPVDVPWGRGDHYPRRSLARDPLCPSRSPSPSAGPLSLAEGGAEDADWGVAAFCPAFFEDPLGTSPLGSSGAPPLPLTGEDELEEVGARRAAQRGHWRSNVSANNNSGSRCPESWDPVSAGGHAEGCPSPKQTPRASPEPGYPGEPLLGLQAASAQEPGCCPGLPHLCSAQGLAPAPCLVTPSWTETASSGGDHPQAEPKLATEAEGTTGPRLPLPSVPSPSQEGAPLPSEEASAPDAPDALPDSPTPATGGEVSAIKLASALNGSSSSPEVEAPSSEDEDTAEATSGIFTDTSSDGLQARRPDVVPAFRSLQKQVGTPDSLDSLDIPSSASDGGYEVFSPSATGPSGGQPRALDSGYDTENYESPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLPSTGQPSEQVCLRPGVSGEAQGSGPGEVLPPLLQLEGSSPEPSTCPSGLVPEPPEPQGPAKVRPGPSPSCSQFFLLTPVPLRSEGNSSEFQGPPGLLSGPAPQKRMGGPGTPRAPLRLALPGLPAALEGRPEEEEEDSEDSDESDEELRCYSVQEPSEDSEEEAPAVPVVVAESQSARNLRSLLKMPSLLSETFCEDLERKKKAVSFFDDVTVYLFDQESPTRELGEPFPGAKESPPTFLRGSPGSPSAPNRPQQADGSPNGSTAEEGGGFAWDDDFPLMTAKAAFAMALDPAAPAPAAPTPTPAPFSRFTVSPAPTSRFSITHVSDSDAESKRGPEAGAGGESKEA AD46BD688AF7103E lmtk1_human Serine/threonine-protein kinase LMTK1 AATK AATYK KIAA0641 LMR1 LMTK1 Lemur tyrosine kinase 1 Apoptosis-associated tyrosine kinase Brain apoptosis-associated tyrosine kinase CDK5-binding protein p35-binding protein protein protein human Homo sapiens Human MSSSFFNPSFAFSSHFDPDGAPLSELSWPSSLAVVAVSFSGLFAVIVLMLACLCCKKGGIGFKEFENAEGDEYAADLAQGSPATAAQNGPDVYVLPLTEVSLPMAKQPGRSVQLLKSTDVGRHSLLYLKEIGRGWFGKVFLGEVNSGISSAQVVVKELQASASVQEQMQFLEEVQPYRALKHSNLLQCLAQCAEVTPYLLVMEFCPLGDLKGYLRSCRVAESMAPDPRTLQRMACEVACGVLHLHRNNFVHSDLALRNCLLTADLTVKIGDYGLAHCKYREDYFVTADQLWVPLRWIAPELVDEVHSNLLVVDQTKSGNVWSLGVTIWELFELGTQPYPQHSDQQVLAYTVREQQLKLPKPQLQLTLSDRWYEVMQFCWLQPEQRPTAEEVHLLLSYLCAKGATEAEEEFERRWRSLRPGGGGVGPGPGAAGPMLGGVVELAAASSFPLLEQFAGDGFHADGDDVLTVTETSRGLNFEYKWEAGRGAEAFPATLSPGRTARLQELCAPDGAPPGVVPVLSAHSPSLGSEYFIRLEEAAPAAGHDPDCAGCAPSPPATADQDDDSDGSTAASLAMEPLLGHGPPVDVPWGRGDHYPRRSLARDPLCPSRSPSPSAGPLSLAEGGAEDADWGVAAFCPAFFEDPLGTSPLGSSGAPPLPLTGEDELEEVGARRAAQRGHWRSNVSANNNSGSRCPESWDPVSAGGHAEGCPSPKQTPRASPEPGYPGEPLLGLQAASAQEPGCCPGLPHLCSAQGLAPAPCLVTPSWTETASSGGDHPQAEPKLATEAEGTTGPRLPLPSVPSPSQEGAPLPSEEASAPDAPDALPDSPTPATGGEVSAIKLASALNGSSSSPEVEAPSSEDEDTAEATSGIFTDTSSDGLQARRPDVVPAFRSLQKQVGTPDSLDSLDIPSSASDGGYEVFSPSATGPSGGQPRALDSGYDTENYESPEFVLKEAQEGCEPQAFAELASEGEGPGPETRLSTSLSGLNEKNPYRDSAYFSDLEAEAEATSGPEKKCGGDRAPGPELGLPSTGQPSEQVCLRPGVSGEAQGSGPGEVLPPLLQLEGSSPEPSTCPSGLVPEPPEPQGPAKVRPGPSPSCSQFFLLTPVPLRSEGNSSEFQGPPGLLSGPAPQKRMGGPGTPRAPLRLALPGLPAALEGRPEEEEEDSEDSDESDEELRCYSVQEPSEDSEEEAPAVPVVVAESQSARNLRSLLKMPSLLSETFCEDLERKKKAVSFFDDVTVYLFDQESPTRELGEPFPGAKESPPTFLRGSPGSPSAPNRPQQADGSPNGSTAEEGGGFAWDDDFPLMTAKAAFAMALDPAAPAPAAPTPTPAPFSRFTVSPAPTSRFSITHVSDSDAESKRGPEAGAGGESKEA AD46BD688AF7103E cdk5_human Cyclin-dependent-like kinase 5 CDK5 Cell division protein kinase 5 Tau protein kinase II catalytic subunit Serine/threonine-protein kinase PSSALRE CDKN5 protein protein human Homo sapiens Human MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP DIP protein Q00535 original sequence version: 129 DIP protein Q00535 original sequence version: 140 54D10495F017D527 cd5r1_human Cyclin-dependent kinase 5 activator 1 Cyclin-dependent kinase 5 regulatory subunit 1 TPKII regulatory subunit CDK5R1 CDK5R NCK5A protein protein human Homo sapiens Human MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR DIP protein Q15078 original sequence version: 119 DIP protein Q15078 original sequence version: 130 DIP protein Q15078 original sequence version: 109 D1C29A07AFF1B644 cdk5_rat Cyclin-dependent-like kinase 5 Cdk5 Cell division protein kinase 5 Tau protein kinase II catalytic subunit Serine/threonine-protein kinase PSSALRE Cdkn5 protein protein rat Rattus norvegicus (Rat) Rat MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSLLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP DIP protein Q03114 original sequence version: 60 4CBFF80794F931DF q6zmq8-2 Serine/threonine-protein kinase LMTK1 AATK AATYK KIAA0641 LMR1 LMTK1 Apoptosis-associated tyrosine kinase Brain apoptosis-associated tyrosine kinase CDK5-binding protein Lemur tyrosine kinase 1 p35-binding protein hAATYKs-p35BP protein protein human Homo sapiens Human MLGGVVELAAASSFPLLEQFAGDGFHADGDDVLTELCAPDGAPPGVVPVLSAHSPSLGSEYFIRLEEAAPAAGHDPDCAGCAPSPPATADQDDDSDGSTAASLAMEPLLGHGPPVDVPWGRGDHYPRRSLARDPLCPSRSPSPSAGPLSLAEGGAEDADWGVAAFCPAFFEDPLGTSPLGSSGAPPLPLTGEDELEEVGARRAAQRGHWRSNVSANNNSGSRCPESWDPVSAGGHAEGCPSPKQTPRASPEPGYPGEPLLGLQAASAQEPGCCPGLPHLCSAQGLAPAPCLVTPSWTETASSGGDHPQAEPKLATEAEGTTGPRLPLPSVPSPSQEGAPLPSEEASAPDAPDALPDSPTPATGGEVSAIKLASALNGSSSSPEVEAPSSEDEDTAEATSGIFTDTSSDGLQARRPDVVPAFRSLQKQWPQREESLPRLCLLLRPRG 38EA067D9AA55653 cd5r1-aatk-1 2 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Screening of a splice variant of the human homologue of AATYK as a p35 binding protein by the yeast two-hybrid system Fig. 1A cdk5r1-aatk-2 3 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association These results indicate that the region of hAATYKs-p35BP critical for binding to p35 is located in the 17 N-terminal amino acids between amino acid residues 40 and 56 (indicated by black in p35BPN169) and that the C-terminal region may assist in the binding. Fig. 2B cdk5r1-aatk-3 3 10 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role prey prey physical association physical association From these studies, it was found that deletion of only the C-terminal 16 amino acids from p35 resulted in complete loss of hAATYKs-p35BP binding activity. Fig. 2A cdk5r1-aatk-4 4 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association Binding of hAATYKs-p35BPN169 to rat brain Cdk5/p35 Fig. 3A cdk5r1-aatk-5 5 12 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role ancillary ancillary spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 9 enzyme enzyme neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation hAATYKs and KIAA0641 were phosphorylated by Cdk5/p35 in vitro Fig. 4C Phosphorlaytion of Q6ZMQ8-2 cdk5r1-aatk-6 5 8 enzyme target enzyme target substrate substrate neutral component neutral component human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role ancillary ancillary spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 9 enzyme enzyme neutral component neutral component spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation hAATYKs and KIAA0641 were phosphorylated by Cdk5/p35 in vitro Fig. 4C Phosphorylation of Q6ZMQ8 cd5r1-aatk-2 1 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association p35 was detected in the anti-hAATYK immunoprecipitate of the cell lysate cotransfected with hAATYKs (Fig. 5A). Fig. 5A CDK5 (Q00535) cd5r1-aatk-3 1 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association p35 was detected in the anti-hAATYK immunoprecipitate of the cell lysate cotransfected with hAATYKs (Fig. 5A). Fig. 5A CDK5 (Q00535) cdk5-aatk-4 1 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Association of hAATYKs or KIAA0641 was also observed in the immunoprecipitate of the HEK293 cell extract with anti-Cdk5 antibody ( Fig. 5B) Fig. 5B CDK5R1 was also transfected into the cells cdk5-aatk-1 1 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association p35 was detected in the anti-hAATYK immunoprecipitate of the cell lysate cotransfected with hAATYKs (Fig. 5A). Fig. 5A CDK5R1 was also transfected into the cells cd5r1-aatk-4 1 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association The cell extracts were immunoprecipitated with anti-p35 antibody, followed by immunoblotting with anti-hAATYK antibody Fig. 5C cd5r1-aatk-5 1 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association The cell extracts were immunoprecipitated with anti-p35 antibody, followed by immunoblotting with anti-hAATYK antibody Fig. 5C