IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SKIP3, a novel Drosophila tribbles ortholog, is overexpressed in human tumors and is regulated by hypoxia. SKIP3, a novel Drosophila tribbles ortholog, is overexpressed in human tumors and is regulated by hypoxia. Oncogene (0950-9232) 2003 Bowers AJ., Scully S., Boylan JF. Apoptosis - Interactions involving proteins with a function related to apoptosis human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bowers AJ., Scully S., Boylan JF. Apoptosis - Interactions involving proteins with a function related to apoptosis Oncogene (0950-9232) 2003 SKIP3, a novel Drosophila tribbles ortholog, is overexpressed in human tumors and is regulated by hypoxia. SKIP3, a novel Drosophila tribbles ortholog, is overexpressed in human tumors and is regulated by hypoxia. Oncogene (0950-9232) 2003 Bowers AJ., Scully S., Boylan JF. Apoptosis - Interactions involving proteins with a function related to apoptosis yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bowers AJ., Scully S., Boylan JF. Apoptosis - Interactions involving proteins with a function related to apoptosis Oncogene (0950-9232) 2003 atf5_human Cyclic AMP-dependent transcription factor ATF-5 Activating transcription factor 5 Transcription factor ATFx ATF5 ATFX protein protein human Homo sapiens Human MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGGLPVGGEPLAGDGFSDWMTERVDFTALLPLEPPLPPGTLPQPSPTPPDLEAMASLLKKELEQMEDFFLDAPPLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPVLDTLDLLAIYCRNEAGQEEVGMPPLPPPQQPPPPSPPQPSRLAPYPHPATTRGDRKQKKRDQNKSAALRYRQRKRAEGEALEGECQGLEARNRELKERAESVEREIQYVKDLLIEVYKARSQRTRSC DDB2F907CA0215A0 atf4_human Cyclic AMP-dependent transcription factor ATF-4 Activating transcription factor 4 CREB2 ATF4 TXREB Cyclic AMP-responsive element-binding protein 2 Tax-responsive enhancer element-binding protein 67 protein protein human Homo sapiens Human MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP 3BBB7379DC3B0D07 DIP protein P18848 original sequence version: 181 DIP protein P18848 original sequence version: 117 No Uniprot Update and Caution removed " The protein could not be merged with EBI-12907955 because of some conflicts with the protein sequence (features which cannot be shifted)." -EBI-12907955 no longer exists. 3BBB7379DC3B0D07 trib3_human Tribbles homolog 3 Neuronal cell death-inducible putative kinase p65-interacting inhibitor of NF-kappa-B SINK TRIB3 C20orf97 NIPK SKIP3 TRB3 protein protein human Homo sapiens Human MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGPYVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMHSLVRSRHRIPEPEAAVLFRQMATALAHCHQHGLVLRDLKLCRFVFADRERKKLVLENLEDSCVLTGPDDSLWDKHACPAYVGPEILSSRASYSGKAADVWSLGVALFTMLAGHYPFQDSEPVLLFGKIRRGAYALPAGLSAPARCLVRCLLRREPAERLTATGILLHPWLRQDPMPLAPTRSHLWEAAQVVPDGLGLDEAREEEGDREVVLYG CE15FD89A81E8D63 trib3-atf4-3 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association trib3-atf5-1 2 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association trib3-atf4-4 1 5 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association