IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Endoplasmic reticulum chaperone protein GRP78 protects cells from apoptosis induced by topoisomerase inhibitors: role of ATP binding site in suppression of caspase-7 activation. Endoplasmic reticulum chaperone protein GRP78 protects cells from apoptosis induced by topoisomerase inhibitors: role of ATP binding site in suppression of caspase-7 activation. J. Biol. Chem. (0021-9258) 2003 imex curation Reddy R.K., Mao C., Baumeister P., Austin R.C., Kaufman R.J., Lee A.S. Apoptosis - Interactions involving proteins with a function related to apoptosis amylee@hsc.usc.edu 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions crigr-cho-c1 GRP78 overexpressing, DHFR-deficient CHO cells cho-c1 GRP78-expressing, DHFR-deficient CHO cells (C-.1) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Reddy R.K., Mao C., Baumeister P., Austin R.C., Kaufman R.J., Lee A.S. Apoptosis - Interactions involving proteins with a function related to apoptosis amylee@hsc.usc.edu Accepted 2012-DEC-11 by MGT 18-Dec-2012: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation Endoplasmic reticulum chaperone protein GRP78 protects cells from apoptosis induced by topoisomerase inhibitors: role of ATP binding site in suppression of caspase-7 activation. Endoplasmic reticulum chaperone protein GRP78 protects cells from apoptosis induced by topoisomerase inhibitors: role of ATP binding site in suppression of caspase-7 activation. J. Biol. Chem. (0021-9258) 2003 imex curation Reddy R.K., Mao C., Baumeister P., Austin R.C., Kaufman R.J., Lee A.S. Apoptosis - Interactions involving proteins with a function related to apoptosis amylee@hsc.usc.edu 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions crigr-cho-c1 GRP78 overexpressing, DHFR-deficient CHO cells cho-c1 GRP78-expressing, DHFR-deficient CHO cells (C-.1) confocal microscopy confocal microscopy immunostaining immunostaining Reddy R.K., Mao C., Baumeister P., Austin R.C., Kaufman R.J., Lee A.S. Apoptosis - Interactions involving proteins with a function related to apoptosis amylee@hsc.usc.edu Accepted 2012-DEC-11 by MGT 18-Dec-2012: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation Endoplasmic reticulum chaperone protein GRP78 protects cells from apoptosis induced by topoisomerase inhibitors: role of ATP binding site in suppression of caspase-7 activation. Endoplasmic reticulum chaperone protein GRP78 protects cells from apoptosis induced by topoisomerase inhibitors: role of ATP binding site in suppression of caspase-7 activation. J. Biol. Chem. (0021-9258) 2003 imex curation Reddy R.K., Mao C., Baumeister P., Austin R.C., Kaufman R.J., Lee A.S. Apoptosis - Interactions involving proteins with a function related to apoptosis amylee@hsc.usc.edu 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Reddy R.K., Mao C., Baumeister P., Austin R.C., Kaufman R.J., Lee A.S. Apoptosis - Interactions involving proteins with a function related to apoptosis amylee@hsc.usc.edu Accepted 2012-DEC-11 by MGT 18-Dec-2012: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2003 Only protein-protein interactions imex curation bip_crigr Endoplasmic reticulum chaperone BiP HSPA5 78 kDa glucose-regulated protein Binding-immunoglobulin protein GRP78 Heat shock protein 70 family protein 5 Heat shock protein family A member 5 Immunoglobulin heavy chain-binding protein I79_019946 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MKFPMVAAALLLLCAVRAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTSEKDEL 25CF665F59113A49 g3il63_crigr I79_024625 protein protein crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster MADDQNCVAELEKVDPSSEDGVDAKPDRSSIISSILWKKKKNAPPCPVKTTRDRVPTHLYRMDFEKMGKCIIINNKNFDKVTGMDVRNGTDKDAEALFKCFRSLGFDVVVYNDCSCAKMQDLLRKASEEDHSNSACFACVLLSHGEENLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGVQADSGPISETDANPRYKIPVEADFLFAYSTVPGYYSWRNPGKGSWFVQALCSILDEHGKDLEIMQILTRVNDRVARHFESQCDDPCFNEKKQIPCMVSMLTKELYFGR 9224B276A87A7BAD g3i8r9-g3il63 2 4 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization 1c g3il63-g3i8r9 1 4 unspecified role unspecified role prey prey fragment of atp-binding region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait physical association physical association 6a and 6b g3il63-g3i8r9-1 3 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 6a and 6b