IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Inhibition of ubiquitin ligase Siah-1A by disabled-1. Inhibition of ubiquitin ligase Siah-1A by disabled-1. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Park TJ., Hamanaka H., Ohshima T., Watanabe N., Mikoshiba K., Nukina N. Apoptosis - Interactions involving proteins with a function related to apoptosis human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip polyclonal western polyclonal antibody western blot polyclonal western Park TJ., Hamanaka H., Ohshima T., Watanabe N., Mikoshiba K., Nukina N. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Biochem. Biophys. Res. Commun. (0006-291X) 2003 Inhibition of ubiquitin ligase Siah-1A by disabled-1. Inhibition of ubiquitin ligase Siah-1A by disabled-1. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Park TJ., Hamanaka H., Ohshima T., Watanabe N., Mikoshiba K., Nukina N. Apoptosis - Interactions involving proteins with a function related to apoptosis yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Park TJ., Hamanaka H., Ohshima T., Watanabe N., Mikoshiba K., Nukina N. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Biochem. Biophys. Res. Commun. (0006-291X) 2003 Inhibition of ubiquitin ligase Siah-1A by disabled-1. Inhibition of ubiquitin ligase Siah-1A by disabled-1. Biochem. Biophys. Res. Commun. (0006-291X) 2003 Park TJ., Hamanaka H., Ohshima T., Watanabe N., Mikoshiba K., Nukina N. Apoptosis - Interactions involving proteins with a function related to apoptosis in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western Park TJ., Hamanaka H., Ohshima T., Watanabe N., Mikoshiba K., Nukina N. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Biochem. Biophys. Res. Commun. (0006-291X) 2003 dab1_mouse Disabled homolog 1 Dab1 protein protein mouse Mus musculus Mouse MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKGVVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPNSQPLEDFESRFAAATPNRNLSMDFDELLEATKVSAVTQLELFGDMSTPPDITSPPTPATPGDAFLPSSSQTLPGSADVFGSMSFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQIAMGAQPPVAQVIPGAQPIAWGQPGLFPATQQAWPTVAGQFPPAAFMPTQTVMPLAAAMFQGPLTPLATVPGTNDSARSSPQSDKPRQKMGKESFKDFQMVQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQSSPSKSSASHVSDPTADDIFEEGFESPSKSEEQEAPDGSQASSTSDPFGEPSGEPSGDNISPQDGS DIP protein P97318 original sequence version: 94 08404220792B1DB4 sia1a_mouse E3 ubiquitin-protein ligase SIAH1A Seven in absentia homolog 1a RING-type E3 ubiquitin transferase SIAH1A Siah1a protein protein mouse Mus musculus Mouse MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC DIP protein P61092 original sequence version: 36 852EADC5DD4A4FFA dab1-siah1a-1 2 4 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association dab1-siah1a-2 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Dab1 was EGFP-tagged, and Siah1A was flag epitope-tagged. Cell lysate was immunoprecipitataed with anti-Dab1 or anti-Siah. The interaction appeared to be independent of phosphorylation of Dab1. dab1-siah1a-3 3 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association P61092 was GST-tagged.