IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6. Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6. EMBO J. (0261-4189) 2003 Garrard SM., Capaldo CT., Gao L., Rosen MK., Macara IG., Tomchick DR. Apoptosis - Interactions involving proteins with a function related to apoptosis canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Garrard SM., Capaldo CT., Gao L., Rosen MK., Macara IG., Tomchick DR. Apoptosis - Interactions involving proteins with a function related to apoptosis EMBO J. (0261-4189) 2003 Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6. Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6. EMBO J. (0261-4189) 2003 Garrard SM., Capaldo CT., Gao L., Rosen MK., Macara IG., Tomchick DR. Apoptosis - Interactions involving proteins with a function related to apoptosis in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Garrard SM., Capaldo CT., Gao L., Rosen MK., Macara IG., Tomchick DR. Apoptosis - Interactions involving proteins with a function related to apoptosis EMBO J. (0261-4189) 2003 Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6. Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6. EMBO J. (0261-4189) 2003 Garrard SM., Capaldo CT., Gao L., Rosen MK., Macara IG., Tomchick DR. Apoptosis - Interactions involving proteins with a function related to apoptosis in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Garrard SM., Capaldo CT., Gao L., Rosen MK., Macara IG., Tomchick DR. Apoptosis - Interactions involving proteins with a function related to apoptosis EMBO J. (0261-4189) 2003 pak1_human Serine/threonine-protein kinase PAK 1 PAK1 p21-activated kinase 1 p65-PAK Alpha-PAK protein protein human Homo sapiens Human MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH DIP protein Q13153 original sequence version: 161 DIP protein Q13153 original sequence version: 122 DIP protein Q13153 original sequence version: 134 DIP protein Q13153 original sequence version: 165 1A95CD5F2195CD7B cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL 51A437E22A4D8FFF par6b_mouse Partitioning defective 6 homolog beta Pard6b Par6b protein protein mouse Mus musculus Mouse MNRGHRHGASSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIRKKNMLSNVLRPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVRVTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRNNVVRNSRTSGSSSQSTDNSLLGFPQQVEASFEPEDQDSDEDDIIIEDSGEPQQIPKATPAQSLESLTQIELSFESGQNGFSPPQDTSLVPVPGSLDTELESRAPDQKLLEEDGTIITL 664C7D25262494A9 cdc42-pard6b-4 3 6 unspecified role unspecified role neutral component neutral component crib-pdz domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component P60953:p.Glu62Leu mutation mutation certain certain sequence position certain certain certain sequence position certain E L Wed May 02 19:03:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu62leu' Tue Jun 30 18:30:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu62Leu' ecoli Escherichia coli (strain K12) direct interaction direct interaction working 21.9%, free 27.3% 2.10A Q61L cdc42 is constitutively active form and can bind effectors isoform2 cdc42-pard6b-5 1 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey P60953:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 18:15:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 17:20:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P60953:p.Phe37Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F A Wed May 02 19:44:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe37ala' Tue Jun 30 17:27:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe37Ala' P60953:p.Tyr40Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y K Wed May 02 18:37:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40lys' Tue Jun 30 17:35:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr40Lys' P60953:p.Asp38Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 19:37:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp38ala' Tue Jun 30 15:48:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp38Ala' ecoli Escherichia coli (strain K12) physical association physical association G12V cdc42 is constitutively active form and can bind effectors isoform2 the mutation D38A (in the mutant background G12V) has only a mild effect and par6 binding can still be detected cdc42-pak1-6 1 5 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P60953:p.Asp38Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 18:05:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp38ala' Tue Jun 30 20:11:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp38Ala' P60953:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 17:29:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 19:57:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' P60953:p.Tyr40Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y K Wed May 02 18:48:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40lys' Tue Jun 30 17:51:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr40Lys' ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait crib binding region binding-associated region binding region range range range range physical association physical association G12V cdc42 is constitutively active form and can bind effectors isoform2 cdc42-pard6b-6 2 5 unspecified role unspecified role neutral component neutral component P60953:p.Gln61Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 17:09:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln61leu' Tue Jun 30 16:04:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln61Leu' P60953:p.Asp38Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 19:30:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp38ala' Tue Jun 30 15:46:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp38Ala' P60953:p.Tyr40Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y K Wed May 02 15:48:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr40lys' Tue Jun 30 19:09:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr40Lys' ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component crib-pdz domains binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cfp tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range yfp tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Q61L cdc42 is constitutively active form and can bind effectors isoform2 D38A mutation on cdc42 had a milder effect than Y40K on the interaction