IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The role of Vif during HIV-1 infection: interaction with novel host cellular factors. The role of Vif during HIV-1 infection: interaction with novel host cellular factors. J. Clin. Virol. (1386-6532) 2003 Lake JA., Carr J., Feng F., Mundy L., Burrell C., Li P. Apoptosis - Interactions involving proteins with a function related to apoptosis Matchmaker yeast Two-hybrid system 3 was used. fig 2 jill.carr@imvs.sa.gov.au Human leucocyte cDNA library screened. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lake JA., Carr J., Feng F., Mundy L., Burrell C., Li P. Apoptosis - Interactions involving proteins with a function related to apoptosis Matchmaker yeast Two-hybrid system 3 was used. fig 2 jill.carr@imvs.sa.gov.au Annotation to indicate that this entry has been checked and accepted by a senior curator. Human leucocyte cDNA library screened. J. Clin. Virol. (1386-6532) 2003 sat1_human Diamine acetyltransferase 1 SAT1 Spermidine/spermine N(1)-acetyltransferase 1 Putrescine acetyltransferase Polyamine N-acetyltransferase 1 SAT protein protein human Homo sapiens Human MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE DIP protein P21673 original sequence version: 148 6A0578B88CD72F09 q9nwf9-3 E3 ubiquitin-protein ligase RNF216 RNF216 TRIAD3 UBCE7IP1 ZIN RING finger protein 216 Triad domain-containing protein 3 Ubiquitin-conjugating enzyme 7-interacting protein 1 Zinc finger protein inhibiting NF-kappa-B ZIN TRIAD3 RING-type E3 ubiquitin transferase RNF216 protein protein human Homo sapiens Human MADFKVLSSQDIKWALHELKGHYAITRKALSDAIKKWQELSPETSGKRKKRKQMNQYSYIDFKFEQGDIKIEKRMFFLENKRRHCRSYDRRALLPAVQQEQEFYEQKIKEMAEHEDFLLALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLFCKECLIRYAQEAVFGSGKLELSCMEGSCTCSFPTSELEKVLPQTILYKYYERKAEEEVAAAYADELVRCPSCSFPALLDSDVKRFSCPNPHCRKETCRKCQGLWKEHNGLTCEELAEKDDIKYRTSIEEKMTAARIRKCHKCGTGLIKSEGCNRMSCRCGAQMCYLCRVSINGYDHFCQHPRSPGAPCQECSRCSLWTDPTEDDEKLIEEIQKEAEEEQKRKNGENTFKRIGPPLEKPVEKVQRVEALPRPVPQNLPQPQMPPYAFAHPPFPLPPVRPVFNNFPLNMGPIPAPYVPPLPNVRVNYDFGPIHMPLEHNLPMHFGPQPRHRF 4 different alternatively spliced mRNAs code for this protein isoform. 6EB1D218DE2E4E6A vif_hv1n5 Virion infectivity factor SOR protein vif protein protein hv1n5 Human immunodeficiency virus type 1 group M subtype B (isolate NY5) (HIV-1) HIV-1 MENRWQVMIVWQVDRMRINTWKRLVKHHMYISRKAKDWFYRHHYESTNPKISSEVHIPLGDAKLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDPDLADQLIHLHYFDCFSESAIRNTILGRIVSPRCEYQAGHNKVGSLQYLALAALIKPKQIKPPLPSVRKLTEDRWNKPQKTKGHRGSHTMNGH DIP protein P12504 original sequence version: 90 2830B3233E8ECD16 ubce7ip1-vif-4 1 4 unspecified role unspecified role bait bait P12504:p.Gln105_Ile107delinsAlaAlaAla gln105ala&leu106ala&ile107ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain QLI AAA Thu Jul 07 12:17:22 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was gln105ala-leu106ala Fri Jul 22 10:57:11 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'gln105ala,leu106ala,ile107ala' Wed May 02 16:48:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln_leu_ile105-107ala_ala_ala' Tue Jun 30 16:11:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln105_Ile107delinsAlaAlaAla' region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association HIV-1 pNL4.3 corresponding to HIV M19921 (HV1N5) was used to amplify vif. sat-vif-1 1 2 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait ephfo Ephedra foeminea physical association physical association HIV-1 pNL4.3 corresponding to HIV M19921 (HV1N5) was used to amplify vif.