IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Homeodomain-interacting protein kinase 1 modulates Daxx localization, phosphorylation, and transcriptional activity. Homeodomain-interacting protein kinase 1 modulates Daxx localization, phosphorylation, and transcriptional activity. Mol. Cell. Biol. (0270-7306) 2003 imex curation Ecsedy JA., Michaelson JS., Leder P. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Source of protein Daxx taken from PMIDs 10444590 12482920. Source of protein PML taken from PMID 1314166. leder@rascal.med.harvard.edu 22-Jan-2008: Contacted by JYOTI. davet Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ecsedy JA., Michaelson JS., Leder P. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of protein Daxx taken from PMIDs 10444590 12482920. Source of protein PML taken from PMID 1314166. leder@rascal.med.harvard.edu Accepted 2007-Not a month!-6 by DAVET. 22-Jan-2008: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2003 davet Only protein-protein interactions imex curation Homeodomain-interacting protein kinase 1 modulates Daxx localization, phosphorylation, and transcriptional activity. Homeodomain-interacting protein kinase 1 modulates Daxx localization, phosphorylation, and transcriptional activity. Mol. Cell. Biol. (0270-7306) 2003 imex curation Ecsedy JA., Michaelson JS., Leder P. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Source of protein Daxx taken from PMIDs 10444590 12482920. Source of protein PML taken from PMID 1314166. leder@rascal.med.harvard.edu 22-Jan-2008: Contacted by JYOTI. davet Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Ecsedy JA., Michaelson JS., Leder P. Apoptosis - Interactions involving proteins with a function related to apoptosis Please note the roles for the HIPK1 autophosphorylaton. This is because it isnot proven whether it is intra- or inter-molecular phosphorylation. Self is only for intra. See the new rules in the curation manual. Source of protein Daxx taken from PMIDs 10444590 12482920. Source of protein PML taken from PMID 1314166. leder@rascal.med.harvard.edu Accepted 2007-Not a month!-6 by DAVET. 22-Jan-2008: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2003 davet Only protein-protein interactions imex curation Homeodomain-interacting protein kinase 1 modulates Daxx localization, phosphorylation, and transcriptional activity. Homeodomain-interacting protein kinase 1 modulates Daxx localization, phosphorylation, and transcriptional activity. Mol. Cell. Biol. (0270-7306) 2003 imex curation Ecsedy JA., Michaelson JS., Leder P. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Source of protein Daxx taken from PMIDs 10444590 12482920. Source of protein PML taken from PMID 1314166. leder@rascal.med.harvard.edu 22-Jan-2008: Contacted by JYOTI. davet Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Ecsedy JA., Michaelson JS., Leder P. Apoptosis - Interactions involving proteins with a function related to apoptosis Add GO term for POD to interaction when becomes available Source of protein Daxx taken from PMIDs 10444590 12482920. Source of protein PML taken from PMID 1314166. leder@rascal.med.harvard.edu Accepted 2007-Not a month!-6 by DAVET. 22-Jan-2008: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2003 davet Only protein-protein interactions imex curation Homeodomain-interacting protein kinase 1 modulates Daxx localization, phosphorylation, and transcriptional activity. Homeodomain-interacting protein kinase 1 modulates Daxx localization, phosphorylation, and transcriptional activity. Mol. Cell. Biol. (0270-7306) 2003 imex curation Ecsedy JA., Michaelson JS., Leder P. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Source of protein Daxx taken from PMIDs 10444590 12482920. Source of protein PML taken from PMID 1314166. leder@rascal.med.harvard.edu 22-Jan-2008: Contacted by JYOTI. davet Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ecsedy JA., Michaelson JS., Leder P. Apoptosis - Interactions involving proteins with a function related to apoptosis Source of protein Daxx taken from PMIDs 10444590 12482920. Source of protein PML taken from PMID 1314166. leder@rascal.med.harvard.edu Accepted 2007-Not a month!-6 by DAVET. Mol. Cell. Biol. (0270-7306) 2003 davet Only protein-protein interactions imex curation pml_human Protein PML PML MYL RNF71 TRIM19 Tripartite motif-containing protein 19 RING finger protein 71 Promyelocytic leukemia protein PP8675 E3 SUMO-protein ligase PML RING-type E3 SUMO transferase PML protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPEEAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS DIP protein P29590 original sequence version: 188 DIP protein P29590 original sequence version: 195 DIP protein P29590-1 original sequence version: 187 D50968A977E34287 hipk1_human Homeodomain-interacting protein kinase 1 MYAK NBAK2 Nuclear body-associated kinase 2 HIPK1 KIAA0630 protein protein human Homo sapiens Human MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQANSSHQVANFNIPAYDQGLLLPAPAVEHIVVTAADSSGSAATSTFQSSQTLTHRSNVSLLEPYQKCGLKRKSEEVDSNGSVQIIEEHPPLMLQNRTVVGAAATTTTVTTKSSSSSGEGDYQLVQHEILCSMTNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGYPLWRLKTPEEHELETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTDMLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMTHLLDFPHSNHVKSCFQNMEICKRRVHMYDTVSQIKSPFTTHVAPNTSTNLTMSFSNQLNTVHNQASVLASSSTAAAATLSLANSDVSLLNYQSALYPSSAAPVPGVAQQGVSLQPGTTQICTQTDPFQQTFIVCPPAFQTGLQATTKHSGFPVRMDNAVPIVPQAPAAQPLQIQSGVLTQGSCTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVALHNSVQPTAMIPEAMGSGQQLADWRNAHSHGNQYSTIMQQPSLLTNHVTLATAQPLNVGVAHVVRQQQSSSLPSKKNKQSAPVSSKSSLDVLPSQVYSLVGSSPLRTTSSYNSLVPVQDQHQPIIIPDTPSPPVSVITIRSDTDEEEDNKYKPSSSGLKPRSNVISYVTVNDSPDSDSSLSSPYSTDTLSALRGNSGSVLEGPGRVVADGTGTRTIIVPPLKTQLGDCTVATQASGLLSNKTKPVASVSGQSSGCCITPTGYRAQRGGTSAAQPLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHSTGHPHLAPAPAHLPSQAHLYTYAAPTSAAALGSTSSIAHLFSPQGSSRHAAAYTTHPSTLVHQVPVSVGPSLLTSASVAPAQYQHQFATQSYIGSSRGSTIYTGYPLSPTKISQYSYL DB0BBFA6DF152909 hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 daxx_mouse Death domain-associated protein 6 Daxx Daxx protein protein mouse Mus musculus Mouse MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSSNSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSVFLASAEFCNILSRVLARSRKRPAKIYVYINELCTVLKAHSIKKKLNLAPAASTTSEASGPNPPTEPPSDLTNTENTASEASRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSSYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGLDTFPDYGDVLRAVEKAATRHSLGLPRQQLQLLAQDAFRDVGVRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPTLARRLRENRTLAMNRLDEVISKYAMMQDKTEEGERQKRRARLLGTAPQPSDPPQASSESGEGPSGMASQECPTTSKAETDDDDDDDDDDDEDNEESEEEEEEEEEEKEATEDEDEDLEQLQEDQGGDEEEEGGDNEGNESPTSPSDFFHRRNSEPAEGLRTPEGQQKRGLTETPASPPGASLDPPSTDAESSGEQLLEPLLGDESPVSQLAELEMEALPEERDISSPRKKSEDSLPTILENGAAVVTSTSVNGRVSSHTWRDASPPSKRFRKEKKQLGSGLLGNSYIKEPMAQQDSGQNTSVQPMPSPPLASVASVADSSTRVDSPSHELVTSSLCSPSPSLLLQTPQAQSLRQCIYKTSVATQCDPEEIIVLSDSD DIP protein O35613 original sequence version: 124 8407D5788528AC2D daxx_human Death domain-associated protein 6 DAXX BING2 DAP6 Daxx Fas death domain-associated protein ETS1-associated protein 1 protein protein human Homo sapiens Human MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPSGMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCIPSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD 1B309ADDAA878040 hipk1_mouse Homeodomain-interacting protein kinase 1 Protein kinase Myak Nuclear body-associated kinase 2 Hipk1 Kiaa0630 Myak Nbak2 protein protein mouse Mus musculus Mouse MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQASSSHQVANFNLPAYDQGLLLPAPAVEHIVVTAADSSGSAATATFQSSQTLTHRSNVSLLEPYQKCGLKRKSEEVESNGSVQIIEEHPPLMLQNRTVVGAAATTTTVTTKSSSSSGEGDYQLVQHEILCSMTNSYEVLEFLGRGTFGQVAKCWKRSTKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLKQNKFSPLPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCSTYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTRFFNRDPNLGYPLWRLKTPEEHELETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTDMLAEKADRREYIDLLKKMLTIDADKRITPLKTLNHQFVTMSHLLDFPHSSHVKSCFQNMEICKRRVHMYDTVSQIKSPFTTHVAPNTSTNLTMSFSNQLNTVHNQASVLASSSTAAAATLSLANSDVSLLNYQSALYPSSAAPVPGVAQQGVSLQPGTTQICTQTDPFQQTFIVCPPAFQTGLQATTKHSGFPVRMDNAVPIVPQAPAAQPLQIQSGVLTQGSCTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSAWQQLPGVALHNSVQPAAVIPEAMGSSQQLADWRNAHSHGNQYSTIMQQPSLLTNHVTLATAQPLNVGVAHVVRQQQSSSLPSKKNKQSAPVSSKSSLEVLPSQVYSLVGSSPLRTTSSYNSLVPVQDQHQPIIIPDTPSPPVSVITIRSDTDEEEDNKYKPNSSSLKARSNVISYVTVNDSPDSDSSLSSPHPTDTLSALRGNSGTLLEGPGRPAADGIGTRTIIVPPLKTQLGDCTVATQASGLLSSKTKPVASVSGQSSGCCITPTGYRAQRGGASAVQPLNLSQNQQSSSASTSQERSSNPAPRRQQAFVAPLSQAPYAFQHGSPLHSTGHPHLAPAPAHLPSQPHLYTYAAPTSAAALGSTSSIAHLFSPQGSSRHAAAYTTHPSTLVHQVPVSVGPSLLTSASVAPAQYQHQFATQSYIGSSRGSTIYTGYPLSPTKISQYSYL 26D264B883220640 hipk1-daxx 4 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 2 A Endogenous Daxx coimmunoprecipitated with endogenous HIPK1 daxx-hipk1 4 10 unspecified role unspecified role prey prey O88904:p.Lys219Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 20:32:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys219ala' Tue Jun 30 16:29:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys219Ala' 9 unspecified role unspecified role bait bait physical association physical association O88904 overexpressed O88904 transfection 2 B, 6 C overexpressed HIPK1 coimmunoprecipitated with endogenous Daxx daxx-hipk1-1 4 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association O88904; O35613 overexpressed O88904; O35613 transfection 2 B overexpressed HIPK1 coimmunoprecipitated with endogenous Daxx and to a much greater degree with overexpressed Daxx daxx-hipk1-2 1 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 2 C The interaction between HIPK1 and Daxx was further verified by means of an in vitro pulldown assay (Fig. 2C). Radiolabeled HIPK1 preferentially associated with a Daxx-GST fusion protein over GST alone. hipk1-daxx-1 2 8 enzyme target enzyme target substrate substrate unspecified role unspecified role human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 enzyme enzyme unspecified role unspecified role O88904:p.Lys219Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 17:19:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys219ala' Wed May 02 18:45:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys219ala' Tue Jun 30 16:33:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys219Ala' phosphorylation phosphorylation reaction phosphorylation 3 B Daxx was also phosphorylated by HIPK1 in vitro Daxx is phosphorylated. hipk1-hipk1 2 10 putative self putative self putative self putative self O88904:p.Lys219Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 14:52:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys219ala' Tue Jun 30 19:47:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys219Ala' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. phosphorylation phosphorylation reaction phosphorylation true 3 B HIPK1 undergoes phosphorylation. HIPK1 but not K219A underwent autophosphorylation daxx-hdac1 4 9 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association 4 C Expression of HIPK1 but not p or K219A disrupted this interaction, as determined by Daxx-PML coimmunoprecipitation Western blots containing Daxx immunoprecipitates and probed for HDAC1 showed that a Daxx-HDAC1 association was present in all samples. HIPK1 - Expression of HIPK1 but not the K219A mutant disrupted the coimmunoprecipitation of PML but not HDAC1 with Daxx. daxx-hdac1-1 4 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 4 C Western blots containing Daxx immunoprecipitates and probed for HDAC1 showed that a Daxx-HDAC1 association was present in all samples. Expression of HIPK1 but not the K219A mutant disrupted the coimmunoprecipitation of PML but not HDAC1 with Daxx. hipk1-pml 3 10 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component colocalization colocalization 4 D O88904; P29590 transfection daxx-hipk1-3 4 10 unspecified role unspecified role prey prey O88904:p.Lys219Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:41:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys219ala' Tue Jun 30 17:01:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys219Ala' 8 unspecified role unspecified role bait bait physical association physical association O88904; O35613 overexpressed O88904; O35613 transfection 6 C Western blots containing Daxx or HIPK1 immunoprecipitates and probed for HIPK1 or Daxx, respectively, showed that Daxx interacted with HIPK1 to a much greater degree than with K219A (Fig. 6C). This was the case for both endogenous and overexpressed Daxx. hipk1-daxx-2 4 10 unspecified role unspecified role bait bait O88904:p.Lys219Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:27:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys219ala' Tue Jun 30 20:11:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys219Ala' 9 unspecified role unspecified role prey prey physical association physical association 6 C O88904; Q9UER7 transfection O88904; Q9UER7 overexpressed Western blots containing Daxx or HIPK1 immunoprecipitates and probed for HIPK1 or Daxx, respectively, showed that Daxx interacted with HIPK1 to a much greater degree than with K219A (Fig. 6C). This was the case for both endogenous and overexpressed Daxx. hipk1-daxx-3 4 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait O88904:p.Lys219Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:49:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys219ala' Tue Jun 30 19:26:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys219Ala' physical association physical association 6 C O88904 transfection O88904 overexpressed Western blots containing Daxx or HIPK1 immunoprecipitates and probed for HIPK1 or Daxx, respectively, showed that Daxx interacted with HIPK1 to a much greater degree than with K219A (Fig. 6C). This was the case for both endogenous and overexpressed Daxx.