IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction of Bruton's tyrosine kinase and protein kinase Ctheta in platelets. Cross-talk between tyrosine and serine/threonine kinases. Interaction of Bruton's tyrosine kinase and protein kinase Ctheta in platelets. Cross-talk between tyrosine and serine/threonine kinases. J. Biol. Chem. (0021-9258) 2002 Crosby D., Poole AW. Apoptosis - Interactions involving proteins with a function related to apoptosis Btk was immunoprecipitated from Nonidet P-40 lysates of basal platelets or platelets stimulated with 3.5 �g/ml alboaggregin A for 60 s 1B, 5C a.poole@bris.ac.uk in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Crosby D., Poole AW. Apoptosis - Interactions involving proteins with a function related to apoptosis Btk was immunoprecipitated from Nonidet P-40 lysates of basal platelets or platelets stimulated with 3.5 �g/ml alboaggregin A for 60 s 1B, 5C a.poole@bris.ac.uk Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2002 Interaction of Bruton's tyrosine kinase and protein kinase Ctheta in platelets. Cross-talk between tyrosine and serine/threonine kinases. Interaction of Bruton's tyrosine kinase and protein kinase Ctheta in platelets. Cross-talk between tyrosine and serine/threonine kinases. J. Biol. Chem. (0021-9258) 2002 Crosby D., Poole AW. Apoptosis - Interactions involving proteins with a function related to apoptosis Btk was immunoprecipitated from Nonidet P-40 lysates of basal platelets or platelets stimulated with 3.5 �g/ml alboaggregin A for 60 s 1B, 5C a.poole@bris.ac.uk human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Crosby D., Poole AW. Apoptosis - Interactions involving proteins with a function related to apoptosis Btk was immunoprecipitated from Nonidet P-40 lysates of basal platelets or platelets stimulated with 3.5 �g/ml alboaggregin A for 60 s 1B, 5C a.poole@bris.ac.uk Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2002 Interaction of Bruton's tyrosine kinase and protein kinase Ctheta in platelets. Cross-talk between tyrosine and serine/threonine kinases. Interaction of Bruton's tyrosine kinase and protein kinase Ctheta in platelets. Cross-talk between tyrosine and serine/threonine kinases. J. Biol. Chem. (0021-9258) 2002 Crosby D., Poole AW. Apoptosis - Interactions involving proteins with a function related to apoptosis Btk was immunoprecipitated from Nonidet P-40 lysates of basal platelets or platelets stimulated with 3.5 �g/ml alboaggregin A for 60 s 1B, 5C a.poole@bris.ac.uk human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte pull down pull down western blot western blot Immuno blot Immuno blot Crosby D., Poole AW. Apoptosis - Interactions involving proteins with a function related to apoptosis Btk was immunoprecipitated from Nonidet P-40 lysates of basal platelets or platelets stimulated with 3.5 �g/ml alboaggregin A for 60 s 1B, 5C a.poole@bris.ac.uk Annotation to indicate that this entry has been checked and accepted by a senior curator. J. Biol. Chem. (0021-9258) 2002 kpct_human Protein kinase C theta type PRKCQ nPKC-theta PRKCT protein protein human Homo sapiens Human MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNARYFLEMSDTKDMNEFETEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPLDEVDKMCHLPEPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPGMERLIS B3C53AB892D5210A fcerg_human High affinity immunoglobulin epsilon receptor subunit gamma IgE Fc receptor subunit gamma Fc-epsilon RI-gamma FCER1G Fc receptor gamma-chain protein protein human Homo sapiens Human MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ DIP protein P30273 original sequence version: 64 2F2C7536513D6165 btk_human Tyrosine-protein kinase BTK Bruton tyrosine kinase B-cell progenitor kinase BPK BTK AGMX1 ATK Agammaglobulinemia tyrosine kinase protein protein human Homo sapiens Human MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSSHRKTKKPLPPTPEEDQILKKPLPPEPAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELINYHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGKWRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANGCLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDFGLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES DIP protein Q06187 original sequence version: 118 DIP protein Q06187 original sequence version: 143 DF06B5D1FEC257CC gpiv-fcer1g-1 2 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Alboaggregin A (snake venom component) 3.5ug/ml for 60 seconds btk-prkcq-1 2 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Alboaggregin A (snake venom component) 3.5ug/ml for 60 seconds btk-prkcq-2 3 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait ph region binding region binding-associated region binding region deletion analysis deletion analysis range range range range region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Interaction does occur under basal conditions but increases on stimulation Alboaggregin A (snake venom component) 3.5ug/ml for various times periods prkcq-1 1 4 putative self putative self putative self putative self phosphorylation phosphorylation reaction phosphorylation true Autophosphorylation of PKC-theta Alboaggregin A (snake venom component) 3.5ug/ml for 60 seconds