IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. J. Biol. Chem. (0021-9258) 2002 imex curation Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-nt2 Homo sapiens neuronal precursor cells nt2 NT2 cells-human neuronal precursor cell line Source of these cells was Stratagene. They were derived from a lung metastasis of a 22 year old Caucasian male with a testicular germ cell tumor. Transplantation into nude mice resulted in a tumor that contained embryonal carcinoma cells. The Ntera-2 (NT2) line was established from this tumor.(taken from the Stratagene info on the web). anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. J. Biol. Chem. (0021-9258) 2002 imex curation Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au Accepted 2011-DEC-15 by JYOTI J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. J. Biol. Chem. (0021-9258) 2002 imex curation Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-nt2 Homo sapiens neuronal precursor cells nt2 NT2 cells-human neuronal precursor cell line Source of these cells was Stratagene. They were derived from a lung metastasis of a 22 year old Caucasian male with a testicular germ cell tumor. Transplantation into nude mice resulted in a tumor that contained embryonal carcinoma cells. The Ntera-2 (NT2) line was established from this tumor.(taken from the Stratagene info on the web). anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. J. Biol. Chem. (0021-9258) 2002 imex curation Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-nt2 Homo sapiens neuronal precursor cells nt2 NT2 cells-human neuronal precursor cell line Source of these cells was Stratagene. They were derived from a lung metastasis of a 22 year old Caucasian male with a testicular germ cell tumor. Transplantation into nude mice resulted in a tumor that contained embryonal carcinoma cells. The Ntera-2 (NT2) line was established from this tumor.(taken from the Stratagene info on the web). anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. J. Biol. Chem. (0021-9258) 2002 imex curation Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. HtrA2 promotes cell death through its serine protease activity and its ability to antagonize inhibitor of apoptosis proteins. J. Biol. Chem. (0021-9258) 2002 imex curation Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Verhagen A.M., Silke J., Ekert P.G., Pakusch M., Kaufmann H., Connolly L.M., Day C.L., Tikoo A., Burke R., Wrobel C., Moritz R.L., Simpson R.J., Vaux D.L. Apoptosis - Interactions involving proteins with a function related to apoptosis Inmunoprecipitates were analyzed by two-dimensional electrophoresis and proteins were visualized by autoradiography. verhagen@wehi.edu.au Accepted 2011-DEC-15 by JYOTI 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2002 Only protein-protein interactions imex curation htra2_human Serine protease HTRA2, mitochondrial High temperature requirement protein A2 Omi stress-regulated endoprotease Serine proteinase OMI Serine protease 25 HTRA2 PRSS25 OMI protein protein human Homo sapiens Human MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSGTSDPRARVTYGTPSLWARLSVGVTEPRACLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE CEA955A7D0DD8C0D htra2_mouse Serine protease HTRA2, mitochondrial Htra2 Omi Prss25 High temperature requirement protein A2 Omi stress-regulated endoprotease Serine proteinase OMI Serine protease 25 protein protein mouse Mus musculus Mouse MAALKAGRGANWSLRAWRALGGIFWRKPPLLAPDLRALLTSGTPDSQIWMTYGTPSLPAQVPEGFLASRADLTSRTPDLWARLNVGTSGSSDQEARRSPGSRRREWLAVAVGAGGAVVLLLWGWGRGLSTVLAAVPAPPPTSPRSQYNFIADVVEKTAPAVVYIEILDRHPFSGREVPISNGSGFVVASDGLIVTNAHVVADRRRVRVRLPSGDTYEAMVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQNNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSWFGTSGSQRRYIGVMMLTLTPSILIELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEKLAQNAEDVYEAVRTQSQLAVRIRRGSETLTLYVTPEVTE DIP protein Q9JIY5 original sequence version: 116 DIP protein Q9JIY5 original sequence version: 79 C1E77346FB8D75BD dbloh_mouse Diablo homolog, mitochondrial Diablo Smac Direct IAP-binding protein with low pI Second mitochondria-derived activator of caspase protein protein mouse Mus musculus Mouse MAALRSWVTRSVCSLFRYRQRFPVLANSKKRCFSELIKPWHKTVLTGFGMTLCAVPIAQKSEPQSLSNEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLVSLYRQYTSLLGKMNSQEEDEVWQVIIGARVEMTSKQQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKSQVQEVRQLSQKAETKLAEAQTKELHQKAQEVSDEGADQEEEAYLRED 6961A7E76C780AC5 dbloh_human Diablo homolog, mitochondrial Second mitochondria-derived activator of caspase Direct IAP-binding protein with low pI DIABLO SMAC protein protein human Homo sapiens Human MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED 70C2AE0DC654D031 xiap_human E3 ubiquitin-protein ligase XIAP Inhibitor of apoptosis protein 3 X-linked inhibitor of apoptosis protein IAP-like protein XIAP API3 IAP3 BIRC4 Baculoviral IAP repeat-containing protein 4 RING-type E3 ubiquitin transferase XIAP protein protein human Homo sapiens Human MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS DIP protein P98170 original sequence version: 168 DIP protein P98170 original sequence version: 118 DIP protein P98170 original sequence version: 153 9D394C16D45EB635 diablo/htra2_chimera Chimera of N-terminal Diablo (1-53) and mature HtrA2 (134-458) protein protein mouse Mus musculus Mouse MAALRSWVTRSVCSLFRYRQRFPVLANSKKRCFSELIKPWHKTVLTGFGMTLCAVPAPPPTSPRSQYNFIADVVEKTAPAVVYIEILDRHPFSGREVPISNGSGFVVASDGLIVTNAHVVADRRRVRVRLPSGDTYEAMVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQNNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSWFGTSGSQRRYIGVMMLTLTPSILIELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEKLAQNAEDVYEAVRTQSQLAVRIRRGSETLTLYVTPEVTE birc2_human Baculoviral IAP repeat-containing protein 2 Inhibitor of apoptosis protein 2 TNFR2-TRAF-signaling complex protein 2 IAP homolog B RING finger protein 48 BIRC2 API1 MIHB RNF48 RING-type E3 ubiquitin transferase BIRC2 Cellular inhibitor of apoptosis 1 protein protein human Homo sapiens Human MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTTGENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILDNLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLRKCPICRGIIKGTVRTFLS C1778D328063586D q65368_npvos Opiap2 protein protein npvos Orgyia pseudotsugata single capsid nuclear polyhedrosis virus MDLQRFNFLIMTTQGRVATMSFMSLDHAQKVDLAKTGLFFHNNLIKCIGCRATMDRVDARRVKRHTYSDTCVSAINALVANESLRKRSFASFKWARRQFGSRAREVDMLSRRGFYCVGKRLRCAGCKVVTTCVSVDGAQRAHAADCAFRRVFDVDLDACALANVVRVDLPPPRLE 94D678A286629246 xiap_mouse E3 ubiquitin-protein ligase XIAP Inhibitor of apoptosis protein 3 X-linked inhibitor of apoptosis protein IAP homolog A Xiap Aipa Api3 Miha Birc4 Baculoviral IAP repeat-containing protein 4 RING-type E3 ubiquitin transferase XIAP protein protein mouse Mus musculus Mouse MTFNSFEGTRTFVLADTNKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDTVQCFSCHAAIDRWQYGDSAVGRHRRISPNCRFINGFYFENGAAQSTNPGIQNGQYKSENCVGNRNPFAPDRPPETHADYLLRTGQVVDISDTIYPRNPAMCSEEARLKSFQNWPDYAHLTPRELASAGLYYTGADDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSESGVSSDRNFPNSTNSPRNPAMAEYEARIVTFGTWTSSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLEESLGRTAEKTPSLTKKIDDTIFQNPMVQEAIRMGFSFKDIKKTMEEKIQTSGSSYLSLEVLIADLVSAQKDNTEDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS DIP protein Q60989 original sequence version: 93 EE5D242D3C3DF12E xiap-diablo 2 10 unspecified role unspecified role prey prey [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 1a Even though the identity of the preys is not given in this experiment, it has been inferred from their identification in later experiments (Htra2) or in previous publications (DIABLO). xiap-htra2 1 10 unspecified role unspecified role prey prey [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey [35s] labelling 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association 1b Even though the identity of the preys is not given in this experiment, it has been inferred from their identification in later experiments (Htra2) or in previous publications (DIABLO). xiap-htra2-1 5 11 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey physical association physical association 1c and 1d xiap-htra2-2 6 8 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 15 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2a xiap-htra2-3 6 8 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role bait bait P98170:p.[Asp148Ala;Asp214Ser;Trp310Ala;Glu314Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D S certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain E S certain certain sequence position certain certain certain sequence position certain D A Fri Jul 22 10:59:16 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp214ser,trp310ala,glu314ser,asp148ala' Wed May 02 20:20:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp148ala,asp214ser,trp310ala,glu314ser' Tue Jun 30 19:14:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp148Ala;Asp214Ser;Trp310Ala;Glu314Ser]' P98170:p.Asp214Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D S Wed May 02 17:58:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp214ser' Tue Jun 30 19:08:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp214Ser' P98170:p.[Asp148Ala;Asp214Ser;Glu314Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A certain certain sequence position certain certain certain sequence position certain D S certain certain sequence position certain certain certain sequence position certain E S Wed May 02 14:29:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp148ala,asp214ser,glu314ser' Tue Jun 30 19:30:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp148Ala;Asp214Ser;Glu314Ser]' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range bir2 domain sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis range range range range bir3 domain sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis range range range range P98170:p.[Asp148Ala;Asp214Ser] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D S certain certain sequence position certain certain certain sequence position certain D A Fri Jul 22 10:55:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp214ser,asp148ala' Wed May 02 19:22:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp148ala,asp214ser' Tue Jun 30 19:58:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp148Ala;Asp214Ser]' P98170:p.[Asp214Ser;Trp310Ala;Glu314Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D S certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain E S Wed May 02 17:47:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp214ser,trp310ala,glu314ser' Tue Jun 30 18:53:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp214Ser;Trp310Ala;Glu314Ser]' physical association physical association 2a, 2b and 3 opiap2-htra2 6 8 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 14 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2a birc2-htra2-1 6 13 unspecified role unspecified role unspecified role unspecified role sequence minus ring domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2a xiap-htra2-4 6 8 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9JIY5:p.Arg144Gly mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R G Wed May 02 15:47:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg144gly' Tue Jun 30 17:51:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg144Gly' 11 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range bir2 domain sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis range range range range physical association physical association 2c xiap-htra2-5 6 8 unspecified role unspecified role prey prey Q9JIY5:p.Tyr147Ile mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y I Wed May 02 20:02:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr147ile' Tue Jun 30 17:11:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr147Ile' ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q9JIY5:p.Arg144Gly mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R G Wed May 02 19:37:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg144gly' Tue Jun 30 18:15:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg144Gly' 11 unspecified role unspecified role bait bait bir3 domain sufficient to bind sufficient binding region sufficient to bind range range range range flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2c xiap-htra2-6 6 8 unspecified role unspecified role prey prey Q9JIY5:p.Arg144Gly mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R G Wed May 02 17:08:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg144gly' Tue Jun 30 18:41:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg144Gly' ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2c xiap-htra2-7 4 8 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 15 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 6c xiap-diablo_htra2 4 12 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range diablo/htra2_chimera:p.Ser226Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:24:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser226ala' Tue Jun 30 19:32:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser226Ala' This mutation maps to residue 306 in the original HtrA2 sequence from which this chimera was built. diablo/htra2_chimera:p.Ala54Gly mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A G Wed May 02 18:19:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala54gly' Tue Jun 30 17:45:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala54Gly' This mutation maps to residue 134 in the original HtrA2 sequence from which this chimera was built. diablo/htra2_chimera:p.[Ala54Gly;Ser226Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A G certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:26:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala54gly,ser226ala' Tue Jun 30 17:47:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ala54Gly;Ser226Ala]' These mutations map to residues 134 and 306 in the original HtrA2 sequence from which this chimera was built. 15 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 6c xiap-diablo-1 3 9 unspecified role unspecified role prey prey Q9JIQ3:p.Ala54Gly mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain A G Wed May 02 16:53:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala54gly' Tue Jun 30 18:38:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala54Gly' 15 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 6c