IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A serine/threonine kinase which causes apoptosis-like cell death interacts with a calcineurin B-like protein capable of binding Na(+)/H(+) exchanger. A serine/threonine kinase which causes apoptosis-like cell death interacts with a calcineurin B-like protein capable of binding Na(+)/H(+) exchanger. J. Biochem. (0021-924X) 2001 Matsumoto M., Miyake Y., Nagita M., Inoue H., Shitakubo D., Takemoto K., Ohtsuka C., Murakami H., Nakamura N., Kanazawa H. Apoptosis - Interactions involving proteins with a function related to apoptosis in vitro In vitro pull down pull down polyclonal western polyclonal antibody western blot polyclonal western Matsumoto M., Miyake Y., Nagita M., Inoue H., Shitakubo D., Takemoto K., Ohtsuka C., Murakami H., Nakamura N., Kanazawa H. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2006-JUN-22 by DAVET. J. Biochem. (0021-924X) 2001 A serine/threonine kinase which causes apoptosis-like cell death interacts with a calcineurin B-like protein capable of binding Na(+)/H(+) exchanger. A serine/threonine kinase which causes apoptosis-like cell death interacts with a calcineurin B-like protein capable of binding Na(+)/H(+) exchanger. J. Biochem. (0021-924X) 2001 Matsumoto M., Miyake Y., Nagita M., Inoue H., Shitakubo D., Takemoto K., Ohtsuka C., Murakami H., Nakamura N., Kanazawa H. Apoptosis - Interactions involving proteins with a function related to apoptosis yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Matsumoto M., Miyake Y., Nagita M., Inoue H., Shitakubo D., Takemoto K., Ohtsuka C., Murakami H., Nakamura N., Kanazawa H. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2006-JUN-22 by DAVET. J. Biochem. (0021-924X) 2001 rhov_rat Rho-related GTP-binding protein RhoV Rhov Rho family GTPase Chp protein protein rat Rattus norvegicus (Rat) Rat MPPRELSEAEPPPLPASTPPPRRRSAPPELGIKCVLVGDGAVGKSSLIVSYTCNGYPSRYRPTALDTFSVQVLVDGAPVRIELWDTAGQEDFDRLRSLCYPDTDVFLACFSVVQPSSFQNITEKWLPEIRTHNPQAPVLLVGTQADLRDDVNVLIQLDQGGREGPVPEPQAQGLAEKIRACCYLECSALTQKNLKEVFDSAILSAIEHKARLEKKLNAKGVRTLSRCRWKKFFCFV 034416FA8CEA2425 sl9a1_rat Sodium/hydrogen exchanger 1 Slc9a1 Nhe1 Na(+)/H(+) exchanger 1 Solute carrier family 9 member 1 protein protein rat Rattus norvegicus (Rat) Rat MMLRWSGIWGLYPPRIFPSLLVVVALVGLLPVLRSHGLQLNPTASTIRGSEPPRERSIGDVTTAPSEPLHHPDDRNLTNLYIEHGAKPVRKAFPVLDIDYLHVRTPFEISLWILLACLMKIGFHVIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLRQFTENLGTILIFAVVGTLWNAFFLGGLLYAVCLVGGEQINNIGLLDTLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFASYEYVGISDIFLGFLSFFVVSLGGVFVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHQWNWTFVISTLLFCLIARVLGVLVLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPSAVSTVSMQNIHPKSAASERILPALSKDKEEEIRKILRSNLQKTRQRLRSYNRHTLVADPYEEAWNQMLLRRQKARQLEQKITNYLTVPAHKLDSPTMSRARIGSDPLAYEPKADLPVITIDPASPQSPESVDLVNEELKGKVLGLKRGPRTTPEEEEEDEDGVIMIRSKEPSSPGTDDVFTPGPSDSPGSQRIQRCLSDPGPHPEPGEGEPFIPKGQ 58398DE74A9642FB st17b_rat Serine/threonine-protein kinase 17B Stk17b Drak2 DAP kinase-related apoptosis-inducing protein kinase 2 protein protein rat Rattus norvegicus (Rat) Rat MSRRRFDCRSISGLLTTTPQTPMKTENFNNFYTLTPKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLELARSCPHVINLHEVYETATEIILVLEYAAGGEIFNLCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGNASELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNPEKRPTAESCLSHSWLQQWDFGSLFHPEETSESSQTQDLSLRSSEDKTPKSCNGSCGDREDKENIPEDDSLLSKRFRFDDSLPSPHELVPDLFC 7BD4E83D98896F4F chp-slc9a1 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association chp-drak2 2 3 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association chp-stk17b 1 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association