IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Localized Rac activation dynamics visualized in living cells. Localized Rac activation dynamics visualized in living cells. Science (0036-8075) 2000 Kraynov VS., Chamberlain C., Bokoch GM., Schwartz MA., Slabaugh S., Hahn KM. Apoptosis - Interactions involving proteins with a function related to apoptosis in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Kraynov VS., Chamberlain C., Bokoch GM., Schwartz MA., Slabaugh S., Hahn KM. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Science (0036-8075) 2000 Localized Rac activation dynamics visualized in living cells. Localized Rac activation dynamics visualized in living cells. Science (0036-8075) 2000 Kraynov VS., Chamberlain C., Bokoch GM., Schwartz MA., Slabaugh S., Hahn KM. Apoptosis - Interactions involving proteins with a function related to apoptosis mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Kraynov VS., Chamberlain C., Bokoch GM., Schwartz MA., Slabaugh S., Hahn KM. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Science (0036-8075) 2000 pak1_human Serine/threonine-protein kinase PAK 1 PAK1 p21-activated kinase 1 p65-PAK Alpha-PAK protein protein human Homo sapiens Human MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH DIP protein Q13153 original sequence version: 161 DIP protein Q13153 original sequence version: 122 DIP protein Q13153 original sequence version: 134 DIP protein Q13153 original sequence version: 165 1A95CD5F2195CD7B rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 rac1-pak1-3 1 4 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component crib domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cysteine-linked dye alexa 546 label alexa 546 label n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction PAK is labelled with the cysteine-selective iodoacetamide dye Alexa 546 on the added cysteine rac1-pak1-4 2 4 unspecified role unspecified role neutral component neutral component mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells 3 unspecified role unspecified role neutral component neutral component crib domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cysteine-linked dye alexa 546 label alexa 546 label n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction PAK is labelled with the cysteine-selective iodoacetamide dye Alexa 546 on the added cysteine PAK1 is micro-injected in cells