IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Self-association of the SET domains of human ALL-1 and of Drosophila TRITHORAX and ASH1 proteins. Self-association of the SET domains of human ALL-1 and of Drosophila TRITHORAX and ASH1 proteins. Oncogene (0950-9232) 2000 imex curation Rozovskaia T., Rozenblatt-Rosen O., Sedkov Y., Burakov D., Yano T., Nakamura T., Petruck S., Ben-Simchon L., Croce CM., Mazo A., Canaani E. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Drosophila third instar larvae cDNA library orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rozovskaia T., Rozenblatt-Rosen O., Sedkov Y., Burakov D., Yano T., Nakamura T., Petruck S., Ben-Simchon L., Croce CM., Mazo A., Canaani E. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2007-FEB-20 by ORCHARD. Drosophila third instar larvae cDNA library Oncogene (0950-9232) 2000 orchard Only protein-protein interactions imex curation Self-association of the SET domains of human ALL-1 and of Drosophila TRITHORAX and ASH1 proteins. Self-association of the SET domains of human ALL-1 and of Drosophila TRITHORAX and ASH1 proteins. Oncogene (0950-9232) 2000 imex curation Rozovskaia T., Rozenblatt-Rosen O., Sedkov Y., Burakov D., Yano T., Nakamura T., Petruck S., Ben-Simchon L., Croce CM., Mazo A., Canaani E. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Drosophila third instar larvae cDNA library orchard Only protein-protein interactions drome Drosophila melanogaster (Fruit fly) Fruit fly anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rozovskaia T., Rozenblatt-Rosen O., Sedkov Y., Burakov D., Yano T., Nakamura T., Petruck S., Ben-Simchon L., Croce CM., Mazo A., Canaani E. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2007-FEB-20 by ORCHARD. Drosophila third instar larvae cDNA library Oncogene (0950-9232) 2000 orchard Only protein-protein interactions imex curation Self-association of the SET domains of human ALL-1 and of Drosophila TRITHORAX and ASH1 proteins. Self-association of the SET domains of human ALL-1 and of Drosophila TRITHORAX and ASH1 proteins. Oncogene (0950-9232) 2000 imex curation Rozovskaia T., Rozenblatt-Rosen O., Sedkov Y., Burakov D., Yano T., Nakamura T., Petruck S., Ben-Simchon L., Croce CM., Mazo A., Canaani E. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Drosophila third instar larvae cDNA library orchard Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Rozovskaia T., Rozenblatt-Rosen O., Sedkov Y., Burakov D., Yano T., Nakamura T., Petruck S., Ben-Simchon L., Croce CM., Mazo A., Canaani E. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2007-FEB-20 by ORCHARD. Drosophila third instar larvae cDNA library Oncogene (0950-9232) 2000 orchard Only protein-protein interactions imex curation Self-association of the SET domains of human ALL-1 and of Drosophila TRITHORAX and ASH1 proteins. Self-association of the SET domains of human ALL-1 and of Drosophila TRITHORAX and ASH1 proteins. Oncogene (0950-9232) 2000 imex curation Rozovskaia T., Rozenblatt-Rosen O., Sedkov Y., Burakov D., Yano T., Nakamura T., Petruck S., Ben-Simchon L., Croce CM., Mazo A., Canaani E. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Drosophila third instar larvae cDNA library orchard Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Rozovskaia T., Rozenblatt-Rosen O., Sedkov Y., Burakov D., Yano T., Nakamura T., Petruck S., Ben-Simchon L., Croce CM., Mazo A., Canaani E. Apoptosis - Interactions involving proteins with a function related to apoptosis The interactions were carried out in COS cells following transfection. Accepted 2007-FEB-20 by ORCHARD. Drosophila third instar larvae cDNA library Oncogene (0950-9232) 2000 orchard Only protein-protein interactions imex curation Self-association of the SET domains of human ALL-1 and of Drosophila TRITHORAX and ASH1 proteins. Self-association of the SET domains of human ALL-1 and of Drosophila TRITHORAX and ASH1 proteins. Oncogene (0950-9232) 2000 imex curation Rozovskaia T., Rozenblatt-Rosen O., Sedkov Y., Burakov D., Yano T., Nakamura T., Petruck S., Ben-Simchon L., Croce CM., Mazo A., Canaani E. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Drosophila third instar larvae cDNA library orchard Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Rozovskaia T., Rozenblatt-Rosen O., Sedkov Y., Burakov D., Yano T., Nakamura T., Petruck S., Ben-Simchon L., Croce CM., Mazo A., Canaani E. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2007-FEB-20 by ORCHARD. Drosophila third instar larvae cDNA library Oncogene (0950-9232) 2000 orchard Only protein-protein interactions imex curation Self-association of the SET domains of human ALL-1 and of Drosophila TRITHORAX and ASH1 proteins. Self-association of the SET domains of human ALL-1 and of Drosophila TRITHORAX and ASH1 proteins. Oncogene (0950-9232) 2000 imex curation Rozovskaia T., Rozenblatt-Rosen O., Sedkov Y., Burakov D., Yano T., Nakamura T., Petruck S., Ben-Simchon L., Croce CM., Mazo A., Canaani E. Apoptosis - Interactions involving proteins with a function related to apoptosis Chromatin - Epigenetic interactions resulting in chromatin modulation Drosophila third instar larvae cDNA library orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Rozovskaia T., Rozenblatt-Rosen O., Sedkov Y., Burakov D., Yano T., Nakamura T., Petruck S., Ben-Simchon L., Croce CM., Mazo A., Canaani E. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2007-FEB-20 by ORCHARD. Drosophila third instar larvae cDNA library Oncogene (0950-9232) 2000 orchard Only protein-protein interactions imex curation lck_human Tyrosine-protein kinase Lck Protein YT16 Proto-oncogene Lck T cell-specific protein-tyrosine kinase LCK Lymphocyte cell-specific protein-tyrosine kinase p56-LCK Leukocyte C-terminal Src kinase protein protein human Homo sapiens Human MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEVPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRLVRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP DIP protein P06239 original sequence version: 164 DIP protein P06239-1 original sequence version: 193 44BFF0D43FFB420D ash1_drome Histone-lysine N-methyltransferase ash1 ash1 CG8887 KMT2H Absent small and homeotic disks protein 1 Lysine N-methyltransferase 2H protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSCSQNETAAAKVLETQRAQESGSENEETDSITDQSSQSKSIKSATQFSVQRSDTDGLRMRISAIRPTLGVVATKKPPKSRKMSTQDTESGCSEAKNRAVSKKVKVKRKKLASSSGISKSDKVSKSKKSQISAFSSDSEDDLPLKVHQQRAPRVLLSAIIQAAQSASKPTLDIGISSSDNELPNLVQAAIKRVESDTEDTTVEGSFRKAAKDKNLPQYQSTLLQDFMEKTQMLGQTVNAKLAEEKVAKAKEETLVQTAVPRKRRGRPKKVVPTVPAPGNSGPAINESADSGVISTTSTTQSTTPSPKMQNENAVPTGSLPIASSSKPKIDMAYLDKRMYATERVLYPPPRSKRRQNNKKTACSSSNKEELQLDPLWREIDVNKKFRLRSMSVGAASGTGASTTICSKVLAAKSGYVSDYGSVRHQRSSHNHNSGYKSDASCKSRYSTKSCMSRRSRAKSCGYRSDCKESGKSGLRMRRKRRASMLLKSSADDTVEDQDILQLAGLSLGQSSEESNEYISKPSLKSLPTTSASKKYGEINRYVTTGQYFGRGGSLSATNPDNFISKMMNQRKETPAPSKSSCKIKSRRSSAASMCSSYVSGVSRMRRRHRRKSFSHNKSLNIDSKLLTEIEIITSTFNSRCRIQDDRLTGSSGKEKLLADANKLQATLAAPSPAQQLTLNGGGPASTLSKPLKRGLKKRKLSEPLVDFAMLSASASGTPNGSGSSNGNTKRRHKKSQSNDSSSPDDHKLPLKKRHYLLTPGERPPAEVAFANGKLNAEAWAAAAAAAKSTASTKSQAQFNARSVKSALTPKKRHLLEQPTSVSGAGSSASNSPLRIVVDNNSISGGKLLDISPSSLCSLKQQRRGGAAKQKVSAAKDLVQLQSPAGSYPPPGVFEPSVELEIQIPLSKLNESVITKAEVESPLLSALDIKEDTKKEVGQRVVETLLHKTGGNLLLKRKRKKINRTGFPTVRRKKRKVSVEQQTTAVIDEHEPEFDPDDEPLQSLRETRSSNNVNVQAAPNPPLDCERVPQAGEARETFVARTNQKAPRLSVVALERLQRPQTPARGRPRGRKPKNREQAEAAPQPPPKSEPEIRPAKKRGRQPKQPVLEEPPPTPPPQQKKNKMEPNIRLPDGIDPNTNFSCKIRLKRRKNLEAGTQPKKEKPVQPVTVEEIPPEIPVSQEEIDAEAEAKRLDSIPTEHDPLPASESHNPGPQDYASCSESSEDKASTTSLRKLSKVKKTYLVAGLFSNHYKQSLMPPPAKVNKKPGLEEQVGPASLLPPPPYCEKYLRRTEMDFELPYDIWWAYTNSKLPTRNVVPSWNYRKIRTNVYAESVRPNLAGFDHPTCNCKNQGEKSCLDNCLNRMVYTECSPSNCPAGEKCRNQKIQRHAVAPGVERFMTADKGWGVRTKLPIAKGTYILEYVGEVVTEKEFKQRMASIYLNDTHHYCLHLDGGLVIDGQRMGSDCRFVNHSCEPNCEMQKWSVNGLSRMVLFAKRAIEEGEELTYDYNFSLFNPSEGQPCRCNTPQCRGVIGGKSQRVKPLPAVEAKPSGEGLSGRNGRQRKQKAKKHAQRQAGKDISSAVAVAKLQPLSEKEKKLVRQFNTFLVRNFEKIRRCKAKRASDAAATASSPALGTTNGDIPGRRPSTPSSPSLAAQISALCSPRNIKTRGLTQAVHDPELEKMAKMAVVLRDICSAMETLKMSDLLTTVSSKKKKPIKTTLSGKLGSTAATSKVEFRSIQAQVEQGHYKTPQEFDDHMQQLFVEAKQQHGDDEGKEKALQSLKDSYEQQKIASYVQLVEILGDSESLQSFKPKEVLSSEEEPGKIAVKKSPGAKERDSPIVPLKVTPPPLLPIEASPDEDVIRCICGLYKDEGLMIQCSKCMVWQHTECTKADIDADNYQCERCEPREVDREIPLEEFTEEGHRYYLSLMRGDLQVRQGDAVYVLRDIPIKDESGKVLPTKKHTYETIGAIDYQECDIFRVEHLWKNELGKRFIFGHHFLRPHETFHEPSRRFYPNEVVRVSLYEVVPIELVIGRCWVLDRTTFCKGRPMECNDEDHCYICELRVDKTARFFSKAKANHPACTKSYAFRKFPEKIKISKSYAPHDVDPSLLKTRKQKTELDVGAGPTTMHKVSGRQEQHQAKMVGRKPRGISAPADATAVHVVTPVAPNKQMLKKRKSRLENVLITMKLKCLDAQTAQEQPIDLSYLLSGRGARQRKTQQSSSSSTANST 0ACBB0BF404848F2 trx_drome Histone-lysine N-methyltransferase trithorax KMT2A Lysine N-methyltransferase 2A trx CG8651 Cysteine methyltransferase KMT2A protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGRSKFPGKPSKSINRKRISVLQLEDDAANPAEPQQPAPESQQPSGSGSGSSAAREKGNNCDNDEDDNAPGGASISGNTASSSAGSGNSGNGSSSGSSTGSGSSGSGSTNGGSVNGGTHHKSAANLDKEAVTKDQNGDGDKTRGNVSSAPSGKLSAAASGKALSKSSRTFSASTSVTSSGRSSGSSPDGNSGASSDGASSGISCGKSTAKSTEASSGKLAKTTGAGTCSSAKSSKASSGTTSEATTSGLSGACLKALFVATPATSTGLACALVSPGGSSQGGTFPISAALLRARKNSNKKFKNLNLARGEVMLPSTSKLKQLNSPVVDNPSPSPPIASGSTPSVEGGIGVGGVVSPGEDAALKRVLTEMPNEVARDPSPSSCTAAANGAASGKGSASNGPPAMASSGDGSSPKSGADTGPSTSSTTAKQKKTVTFRNVLETSDDKSVVKRFYNPDIRIPIVSIMKKDSLNRPLNYSRGGECIVRPSILSKILNKNSNIDKLNSLKFRSAGASSSSSNQESGSSSNVFGLSRAFGAPMDEDDEGGVTFRRNDSPEDQNNAEDDEMDDDDDDEEAEEDDENEDDNDEAVSEKSAETEKSAGADERDPDEKQLVMDSHFVLPKRSTRSSRIIKPNKRLLEEGAISTKKPLSLGDSKGKNVFGTSSSSAGSTASTFSASTNLKLGKETFFNFGTLKPNSSAAGNFVLRQPRLQFQADNQQATFTAPKACPTSPSAIPKPANSLATSSFGSLASTNSSTVTPTPSACSICSAVVSSKEVTQARKYGVVACDVCRKFFSKMTKKSISANSSTANTSSGSQQYLQCKGNEGSPCSIHSAKSQLKNFKKFYKDRCTACWLKKCMISFQLPAAHRSRLSAILPPGMRGEAAAREEKSAELLSPTGSLRFTSTASSSSPSVVASTSVKWKSSGDSTSALTSIKPNPLAENNVTFGSTPLLRPAILENPLFLKISNAADQKLAAAEAISPSLTKKNSKQEKEKVKESEQSEKLLSPTQAGTKKSGAAEAQVEEVQPQKEEAPQTSTTTQPSASNGASHGVPQAELAGETNATGDTLKRQRIDLKGPRVKHVCRSASIVLGQPLATFGEDQQPEDAADMQQEIAAPVPSAIMEPSPEKPTHIVTDENDNCASCKTSPVGDESKPSKSSGSAQAEVKKATALGKEGTASAAGGSSAKVTTRNAAVASNLIVAASKKQRNGDIATSSSVTQSSNQTQGRKTKEHRQQRTLISIDFWENYDPAEVCQTGFGLIVTETVAQRALCFLCGSTGLDPLIFCACCCEPYHQYCVQDEYNLKHGSFEDTTLMGSLLETTVNASTGPSSSLNQLTQRLNWLCPRCTVCYTCNMSSGSKVKCQKCQKNYHSTCLGTSKRLLGADRPLICVNCLKCKSCSTTKVSKFVGNLPMCTGCFKLRKKGNFCPICQRCYDDNDFDLKMMECGDCGQWVHSKCEGLSDEQYNLLSTLPESIEFICKKCARRNESSKIKAEEWRQAVMEEFKASLYSVLKLLSKSRQACALLKLSPRKKLRCTCGASSNQGKLQPKALQFSSGSDNGLGSDGESQNSDDVYEFKDQQQQQQQRNANMNKPRVKSLPCSCQQHISHSQSFSLVDIKQKIAGNSYVSLAEFNYDMSQVIQQSNCDELDIAYKELLSEQFPWFQNETKACTDALEEDMFESCSGGNYEDLQDTGGVSASVYNEHSTSQAESRSGVLDIPLEEVDDFGSCGIKMRLDTRMCLFCRKSGEGLSGEEARLLYCGHDCWVHTNCAMWSAEVFEEIDGSLQNVHSAVARGRMIKCTVCGNRGATVGCNVRSCGEHYHYPCARSIDCAFLTDKSMYCPAHAKNGNALKANGSPSVTYESNFEVSRPVYVELDRKRKKLIEPARVQFHIGSLEVRQLGAIVPRFSDSYEAVVPINFLCSRLYWSSKEPWKIVEYTVRTTIQNSSSTLTALDVGRNYTVDHTNPNSKEVQLGMAQIARWHTSLARSEFLENGGTDWSGEFPNPNSCVPPDENTEEEPQQQADLLPPELKDAIFEDLPHELLDGISMLDIFLYDDKTDLFAISEQSKDGTQAMTSNQAQNQNQQAGGANSVSICDEDTRNSNTSLGNGWPASNPVEDAMLSAARNSSQVQMLKTLAWPKLDGNSAMATAIKRRKLSKNLAEGVFLTLSSQQRNKKEMATVAGVSRRQSISETSVEGVATTSGSVRSKSFTWSAAKRYFEKSEGREEAAKMRIMQMDGVDDSITEFRIISGDGNLSTAQFSGQVKCDRCQCTYRNYDAFQRHLPSCSPTMSSNETESDVSGQGMTNNATQISAESLNELQKQLLANAGGLNYLQSATSFPQVQSLGSLGQFGLQGLQQLQLQPQSLGSGFFLSQPNPATQANTDDLQIYANSLQSLAANLGGGFTLAQPTVTAPAQPQLIAVSTNPDGTQQFIQIPQTMQATTTPTATYQTLQATNTDKKIMLPLTAAGKPLKTVATKAAQQAAVKQRQLKSGHQVKPIQAKLQPHPQQHQQQQQTQVQQPITVMGQNLLQPQLLFQSSTQTQAPQIILPQAQPQNIISFVTGDGSQGQPLQYISIPTAGEYKPQPQPTATPTFLTTAPGAGATYLQTDASGNLVLTTTPSNSGLQMLTAQSLQAQPQVIGTLIQPQTIQLGGGADGNQPGSNQQPLILGGTGGGSSGLEFATTSPQVILATQPMYYGLETIVQNTVMSSQQFVSTAMPGMLSQNASFSATTTQVFQASKIEPIVDLPAGYVVLNNTGDASSAGTFLNAASVLQQQTQDDTTTQILQNANFQFQSVPTSSGASTSMDYTSPVMVTAKIPPVTQIKRTNAQAKAAGISGVGKVPPQPQVVNKVLPTSIVTQQSQVQVKNSNLKQSQVKGKAASGTGTTCGAPPSIASKPLQKKTNMIRPIHKLEVKPKVMKPTPKVQNQNHSLLQQQQQQQPQLQQQIPAVVVNQVPKVTISQQRIPAQTQQQQLQQAQMIHIPQQQQPLQQQQVQVQPSMPIITLAEAPVVQSQFVMEPQALEQQELANRVQHFSTSSSSSSSNCSLPTNVVNPMQQQAPSTTSSSTTRPTNRVLPMQQRQEPAPLSNECPVVSSPTPPKPVEQPIIHQMTSASVSKCYAQKSTLPSPVYEAELKVSSVLESIVPDVTMDAILEEQPVTESIYTEGLYEKNSPGESKTEQLLLQQQQREQLNQQLVNNGYLLDKHTFQVEPMDTDVYREEDLEEEEDEDDDFSLKMATSACNDHEMSDSEEPAVKDKISKILDNLTNDDCADSIATATTMEVDASAGYQQMVEDVLATTAAQSAPTEEFEGALETAAVEAAATYINEMADAHVLDLKQLQNGVELELRRRKEEQRTVSQEQEQSKAAIVPTAAAPEPPQPIQEPKKMTGPHLLYEIQSEDGFTYKSSSITEIWEKVFEAVQVARRAHGLTPLPEGPLADMGGIQMIGLKTNALKYLIEQLPGVEKCSKYTPKYHKRNGNVSTAANGAHGGNLGGSSASAALSVSGGDSHGLLDYGSDQDELEENAYDCARCEPYSNRSEYDMFSWLASRHRKQPIQVFVQPSDNELVPRRGTGSNLPMAMKYRTLKETYKDYVGVFRSHIHGRGLYCTKDIEAGEMVIEYAGELIRSTLTDKRERYYDSRGIGCYMFKIDDNLVVDATMRGNAARFINHCCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFEDEKIPCSCGSKRCRKYLN E3DDB8F062BD7796 med28_human Mediator of RNA polymerase II transcription subunit 28 Mediator complex subunit 28 Tumor angiogenesis marker EG-1 Endothelial-derived protein 1 Merlin and Grb2-interacting cytoskeletal protein MED28 EG1 FKSG20 protein protein human Homo sapiens Human MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT 63DE023972908066 kmt2a_human Histone-lysine N-methyltransferase 2A KMT2A ALL-1 ALL1 CXXC-type zinc finger protein 7 CXXC7 HRX HTRX MLL MLL1 Myeloid/lymphoid or mixed-lineage leukemia Myeloid/lymphoid or mixed-lineage leukemia protein 1 TRX1 Trithorax-like protein Zinc finger protein HRX Cysteine methyltransferase KMT2A protein protein human Homo sapiens Human MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAVAAAAAAAGSSGAGVPGGAAAASAASSSSASSSSSSSSSASSGPALLRVGPGFDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQATKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRIIPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSRFSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGSRTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSNRTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSSSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSGESAEKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQSSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEKTLCLSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSEPPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKEVPKTTPSEPKKKQPPPPESGPEQSKQKKVAPRPSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSNNYQNLPVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPSTQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN DIP protein Q03164 original sequence version: 85 DIP protein Q03164-1 original sequence version: 137 DIP protein Q03164 original sequence version: 140 DIP protein Q03164-1 original sequence version: 141 DIP protein Q03164 original sequence version: 172 DIP protein Q03164-1 original sequence version: 190 DIP protein Q03164-1 original sequence version: 200 DIP protein Q03164 original sequence version: 153 DIP protein Q03164-1 original sequence version: 154 DIP protein Q03164-1 original sequence version: 196 DIP protein Q03164 original sequence version: 159 1150F37EAB1430D3 all1-all1 3 11 unspecified role unspecified role prey prey c term set domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain undetermined Undetermined feature position 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role bait bait c term set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 17 direct interaction direct interaction To demonstrate in vitro binding, TRX, ALL-1 and ASH1 polypeptides spanning the SET domains were linked to GST, expressed in bacteria, and bound to glutathione-Sepharose beads. TRX, ALL-1 and ASH1 SET fragments were synthesized and radiolabeled in a coupled transcription /translation system and examined for binding to the GST chimera polypeptides and to GST alone 1 trx-trx 6 9 unspecified role unspecified role prey prey c terminal set domia sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait c terminal set domai sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 23 21 physical association physical association This clone contained a TRX segment encompassing residues 3389-3759 and spanning the SET domain trx-trx-2 3 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 30 27 direct interaction direct interaction To demonstrate in vitro binding, TRX, ALL-1 and ASH1 polypeptides spanning the SET domains were linked to GST, expressed in bacteria, and bound to glutathione-Sepharose beads. TRX, ALL-1 and ASH1 SET fragments were synthesized and radiolabeled in a coupled transcription /translation system and examined for binding to the GST chimera polypeptides and to GST alone 1 ash1-ash1 3 8 unspecified role unspecified role prey prey set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 33 37 direct interaction direct interaction To demonstrate in vitro binding, TRX, ALL-1 and ASH1 polypeptides spanning the SET domains were linked to GST, expressed in bacteria, and bound to glutathione-Sepharose beads. TRX, ALL-1 and ASH1 SET fragments were synthesized and radiolabeled in a coupled transcription /translation system and examined for binding to the GST chimera polypeptides and to GST alone 1 all1-all1-1 5 11 unspecified role unspecified role prey prey undetermined Undetermined feature position 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c term set domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role bait bait c term set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 41 43 direct interaction direct interaction radiolabeled TRX SET, ALL-1 SET and ASH1 SET polypeptides co-immunoprecipitated with the T7-tagged relevant SET fragments 2 trx-trx-3 5 9 unspecified role unspecified role prey prey set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 9 unspecified role unspecified role bait bait region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 51 47 direct interaction direct interaction radiolabeled TRX SET, ALL-1 SET and ASH1 SET polypeptides co-immunoprecipitated with the T7-tagged relevant SET fragments 2 ash1-ash1-1 5 8 unspecified role unspecified role prey prey set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 57 54 direct interaction direct interaction radiolabeled TRX SET, ALL-1 SET and ASH1 SET polypeptides co-immunoprecipitated with the T7-tagged relevant SET fragments 2 all1-all1-2 4 11 unspecified role unspecified role bait bait region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c term set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c term set domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 65 62 physical association physical association To demonstrate in vivo binding in transfected cells, TRX, ALL-1 and ASH1 SET polypeptides were tagged with the T7 and hemagglutinin (HA) epitopes, and plasmids encoding appropriate partners were transiently cotransfected into COS cells. The proteins produced were examined for co-precipitation by Western blotting. In each case, significant co-precipitation was observed 3 trx-trx-4 4 9 unspecified role unspecified role bait bait set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 68 71 physical association physical association To demonstrate in vivo binding in transfected cells, TRX, ALL-1 and ASH1 SET polypeptides were tagged with the T7 and hemagglutinin (HA) epitopes, and plasmids encoding appropriate partners were transiently cotransfected into COS cells. The proteins produced were examined for co-precipitation by Western blotting. In each case, significant co-precipitation was observed 3 ash1-ash1-2 4 8 unspecified role unspecified role bait bait set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 78 75 physical association physical association To demonstrate in vivo binding in transfected cells, TRX, ALL-1 and ASH1 SET polypeptides were tagged with the T7 and hemagglutinin (HA) epitopes, and plasmids encoding appropriate partners were transiently cotransfected into COS cells. The proteins produced were examined for co-precipitation by Western blotting. In each case, significant co-precipitation was observed 3 trx-trx-5 2 9 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey set domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association In contrast, TRX SET was readily detected in the pellet when either of two different anti-TRX antibodies directed against the N-terminal (N1) or the central (N4) regions of the TRX molecule (Kuzin et al., 1994) were used for 4 trx-trx-6 1 9 unspecified role unspecified role prey prey set domain sufficient to bind sufficient binding region sufficient to bind range range range range in vitro In vitro 9 unspecified role unspecified role bait bait P20659:p.Arg3630Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 14:39:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg3630ala' Tue Jun 30 19:26:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg3630Ala' P20659:p.Pro3670_Asn3671delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain PN AA Wed May 02 19:35:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro_asn3670-3671ala_ala' Tue Jun 30 18:28:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro3670_Asn3671delinsAlaAla' P20659:p.Ile3693Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I A Wed May 02 15:14:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile3693ala' Tue Jun 30 17:39:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile3693Ala' P20659:p.Glu3697_Glu3698delinsAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain EE AA Wed May 02 14:41:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_glu3697-3698ala_ala' Tue Jun 30 16:07:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu3697_Glu3698delinsAlaAla' P20659:p.Asp3702_Tyr3703delinsAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain DY AA Fri Jul 22 10:49:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp_tyr3702-3702ala_ala' Wed May 02 19:14:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp_tyr3702-3703ala_ala' Tue Jun 30 17:53:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp3702_Tyr3703delinsAlaAla' P20659:p.[Gly3599Val;Gly3601Val] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G V certain certain sequence position certain certain certain sequence position certain G V Wed May 02 18:44:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly3599val,gly3601val' Tue Jun 30 17:31:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly3599Val;Gly3601Val]' set domain sufficient to bind sufficient binding region sufficient to bind range range range range P20659:p.Glu3616_Tyr3617delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain EY AA Wed May 02 20:29:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu_tyr3616-3617ala_ala' Tue Jun 30 19:24:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu3616_Tyr3617delinsAlaAla' P20659:p.Val3652_Asp3653delinsAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain VD AA Wed May 02 20:30:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val_asp3652-3653ala_ala' Tue Jun 30 19:11:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val3652_Asp3653delinsAlaAla' P20659:p.Arg3662_Phe3663delinsAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain RF AA Wed May 02 17:22:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_phe3662-3663ala_ala' Tue Jun 30 16:17:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg3662_Phe3663delinsAlaAla' P20659:p.Cys3721_Arg3722delinsAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain CR AA Wed May 02 15:23:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys_arg3721-3722ala_ala' Tue Jun 30 16:32:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys3721_Arg3722delinsAlaAla' ecoli Escherichia coli (strain K12) 95 87 physical association physical association Ten highly conserved amino acids within TRX SET (Tripoulas et al., 1996; Jenuwein et al., 1998) were mutated. These alterations resulted in loss of all or most of all the capacity of the modified polypeptides to self-associate in yeast 5A The authors have not specified the ranges of the SET domains used. lck-med28-2 1 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Coimmunoprecipitations performed with Fyn, Lck or anti-magicin (Tim3) antibodies revealed anin vivo association of magicin with both Fyn and Lck at the endogenous levels in Jurkat cells (Fig. 4B). 4B