IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Investigation of membrane protein-protein interactions using correlative FRET-PLA. Investigation of membrane protein-protein interactions using correlative FRET-PLA. BioTechniques (0736-6205) 2014 imex curation Ivanusic D., Eschricht M., Denner J. Affinomics - Interactions curated for the Affinomics consortium. Virus - Publications including interactions involving viral proteins Dear Checker: the magazine is in the (small) pile on the LHS of my desk, if you want it. dennerj@rki.de Results using pZFN-YFP have not been included as the origin/identity of the protein is not given. 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Ivanusic D., Eschricht M., Denner J. Affinomics - Interactions curated for the Affinomics consortium. Affinomics - Interactions curated for the Affinomics consortium. Dear Checker: the magazine is in the (small) pile on the LHS of my desk, if you want it. Correlative FRET-PLA analysis;cell samples are processed for PLA and the next day for CFP/YFP/PLA image acquisition. NFRET - is used here (results obtained are independent of protein expression levels.) FRET interaction data was also obtained using acceptor photobleaching.(figure 3) dennerj@rki.de Results using pZFN-YFP have not been included as the origin/identity of the protein is not given. Accepted 2015-FEB-02 by ORCHARD BioTechniques (0736-6205) 2014 Only protein-protein interactions imex curation Investigation of membrane protein-protein interactions using correlative FRET-PLA. Investigation of membrane protein-protein interactions using correlative FRET-PLA. BioTechniques (0736-6205) 2014 imex curation Ivanusic D., Eschricht M., Denner J. Affinomics - Interactions curated for the Affinomics consortium. Virus - Publications including interactions involving viral proteins Dear Checker: the magazine is in the (small) pile on the LHS of my desk, if you want it. dennerj@rki.de Results using pZFN-YFP have not been included as the origin/identity of the protein is not given. 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Ivanusic D., Eschricht M., Denner J. Affinomics - Interactions curated for the Affinomics consortium. Affinomics - Interactions curated for the Affinomics consortium. Dear Checker: the magazine is in the (small) pile on the LHS of my desk, if you want it. dennerj@rki.de Results using pZFN-YFP have not been included as the origin/identity of the protein is not given. Accepted 2015-FEB-02 by ORCHARD Jurkat cDNA library BioTechniques (0736-6205) 2014 Only protein-protein interactions imex curation Investigation of membrane protein-protein interactions using correlative FRET-PLA. Investigation of membrane protein-protein interactions using correlative FRET-PLA. BioTechniques (0736-6205) 2014 imex curation Ivanusic D., Eschricht M., Denner J. Affinomics - Interactions curated for the Affinomics consortium. Virus - Publications including interactions involving viral proteins Dear Checker: the magazine is in the (small) pile on the LHS of my desk, if you want it. dennerj@rki.de Results using pZFN-YFP have not been included as the origin/identity of the protein is not given. 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Ivanusic D., Eschricht M., Denner J. Affinomics - Interactions curated for the Affinomics consortium. Affinomics - Interactions curated for the Affinomics consortium. Dear Checker: the magazine is in the (small) pile on the LHS of my desk, if you want it. dennerj@rki.de Results using pZFN-YFP have not been included as the origin/identity of the protein is not given. Accepted 2015-FEB-02 by ORCHARD BioTechniques (0736-6205) 2014 Only protein-protein interactions imex curation cd63_human CD63 antigen Melanoma-associated antigen ME491 Ocular melanoma-associated antigen OMA81H Granulophysin Tetraspanin-30 Lysosomal-associated membrane protein 3 CD63 MLA1 TSPAN30 Lysosome integral membrane protein 1 protein protein human Homo sapiens Human MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM 85AC8E235C6E425F p04578-pro_0000038428 Transmembrane protein gp41 env Env polyprotein protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 AVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSNKSLEQIWNHTTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSIVNRVRQGYSPLSFQTHLPTPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGACRAIRHIPRRIRQGLERILL DIP protein P04578-PRO_0000038428 original sequence version: 128 512 856 F3866644E571C138 env-cd63 2 5 unspecified role unspecified role bait bait region cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey n_terminus nub nub n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp 1 cd63-env 3 4 unspecified role unspecified role neutral component neutral component n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role neutral component neutral component c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nhr_chr_tm sufficient to bind sufficient binding region sufficient to bind range range range range proximity proximity close-contact colocalization neighbourhood interaction 2A cd63-env-1 1 5 unspecified role unspecified role neutral component neutral component c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined nhr_chr_tm sufficient to bind sufficient binding region sufficient to bind range range range range c_terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range signal_igk_light chain_v-j2-c tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range protein ID=AAA38856.1 4 unspecified role unspecified role neutral component neutral component n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction 2 B/C, 3, 4G The amount of PLA signals strongly correlated with the NFRET value (Figure 2C). cd63-env-2 3 4 unspecified role unspecified role neutral component neutral component n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range true c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range true 5 unspecified role unspecified role neutral component neutral component c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true c_terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range true signal_igk_light chain_v-j2-c tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range true protein ID=AAA38856.1 nhr_chr_tm sufficient to bind sufficient binding region sufficient to bind range range range range true proximity proximity close-contact colocalization neighbourhood interaction 4G The amount of PLA signals strongly correlated with the NFRET value (Figure 2C).