IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Sin3b interacts with Myc and decreases Myc levels. Sin3b interacts with Myc and decreases Myc levels. J. Biol. Chem. (0021-9258) 2014 imex curation Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. Have not really entered many causality statements as cell lines used are not the same for mRNA expression and ChIPs. Fig 9 - I have entered one statement here to last Experiment, - but the genes in the ChIps are not involved in possible statements, so remove if you dont think it appropriate to add. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es Accepted 2015-MAR-13 by ORCHARD mouse NIH3T3 fibroblast cDNA library J. Biol. Chem. (0021-9258) 2014 imex curation Sin3b interacts with Myc and decreases Myc levels. Sin3b interacts with Myc and decreases Myc levels. J. Biol. Chem. (0021-9258) 2014 imex curation Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. Have not really entered many causality statements as cell lines used are not the same for mRNA expression and ChIPs. Fig 9 - I have entered one statement here to last Experiment, - but the genes in the ChIps are not involved in possible statements, so remove if you dont think it appropriate to add. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es Only protein-protein interactions human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. Have not really entered many causality statements as cell lines used are not the same for mRNA expression and ChIPs. Fig 9 - I have entered one statement here to last Experiment, - but the genes in the ChIps are not involved in possible statements, so remove if you dont think it appropriate to add. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es Accepted 2015-MAR-16 by ORCHARD J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Sin3b interacts with Myc and decreases Myc levels. Sin3b interacts with Myc and decreases Myc levels. J. Biol. Chem. (0021-9258) 2014 imex curation Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. Have not really entered many causality statements as cell lines used are not the same for mRNA expression and ChIPs. Fig 9 - I have entered one statement here to last Experiment, - but the genes in the ChIps are not involved in possible statements, so remove if you dont think it appropriate to add. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es Only protein-protein interactions human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. Re-ChIp experiment - Two rounds of IPs:the Bait of the first round of IPs is taken as a Prey for the second round. fportillo@iib.uam.es,leonj@unican.es Accepted 2015-MAR-16 by ORCHARD J. Biol. Chem. (0021-9258) 2014 imex curation Sin3b interacts with Myc and decreases Myc levels. Sin3b interacts with Myc and decreases Myc levels. J. Biol. Chem. (0021-9258) 2014 imex curation Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. Have not really entered many causality statements as cell lines used are not the same for mRNA expression and ChIPs. Fig 9 - I have entered one statement here to last Experiment, - but the genes in the ChIps are not involved in possible statements, so remove if you dont think it appropriate to add. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. fportillo@iib.uam.es,leonj@unican.es Accepted 2015-MAR-13 by ORCHARD J. Biol. Chem. (0021-9258) 2014 imex curation Sin3b interacts with Myc and decreases Myc levels. Sin3b interacts with Myc and decreases Myc levels. J. Biol. Chem. (0021-9258) 2014 imex curation Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. Have not really entered many causality statements as cell lines used are not the same for mRNA expression and ChIPs. Fig 9 - I have entered one statement here to last Experiment, - but the genes in the ChIps are not involved in possible statements, so remove if you dont think it appropriate to add. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es Only protein-protein interactions human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. K562/S cells;a K562 subclone able to grow attached to plastic. fportillo@iib.uam.es,leonj@unican.es Accepted 2015-MAR-13 by ORCHARD J. Biol. Chem. (0021-9258) 2014 imex curation Sin3b interacts with Myc and decreases Myc levels. Sin3b interacts with Myc and decreases Myc levels. J. Biol. Chem. (0021-9258) 2014 imex curation Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. Have not really entered many causality statements as cell lines used are not the same for mRNA expression and ChIPs. Fig 9 - I have entered one statement here to last Experiment, - but the genes in the ChIps are not involved in possible statements, so remove if you dont think it appropriate to add. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es Only protein-protein interactions rat-ur61 RAT UR61 pheochromocytoma cell ur61 UR61 -PC12/U7 -derived Rat pheochromocytoma cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. fportillo@iib.uam.es,leonj@unican.es Accepted 2015-MAR-13 by ORCHARD mouse NIH3T3 fibroblast cDNA library J. Biol. Chem. (0021-9258) 2014 imex curation Sin3b interacts with Myc and decreases Myc levels. Sin3b interacts with Myc and decreases Myc levels. J. Biol. Chem. (0021-9258) 2014 imex curation Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. Have not really entered many causality statements as cell lines used are not the same for mRNA expression and ChIPs. Fig 9 - I have entered one statement here to last Experiment, - but the genes in the ChIps are not involved in possible statements, so remove if you dont think it appropriate to add. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es Only protein-protein interactions human-p493-6 Human P493-6 B cell line (condtiional myc) p493-6 Human P493-6 B cell line (condtiional myc) ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. fportillo@iib.uam.es,leonj@unican.es Accepted 2015-MAR-13 by ORCHARD J. Biol. Chem. (0021-9258) 2014 imex curation Sin3b interacts with Myc and decreases Myc levels. Sin3b interacts with Myc and decreases Myc levels. J. Biol. Chem. (0021-9258) 2014 imex curation Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. Have not really entered many causality statements as cell lines used are not the same for mRNA expression and ChIPs. Fig 9 - I have entered one statement here to last Experiment, - but the genes in the ChIps are not involved in possible statements, so remove if you dont think it appropriate to add. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es Only protein-protein interactions human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. K562/S cells;a K562 subclone able to grow attached to plastic. fportillo@iib.uam.es,leonj@unican.es Accepted 2015-MAR-13 by ORCHARD J. Biol. Chem. (0021-9258) 2014 imex curation Sin3b interacts with Myc and decreases Myc levels. Sin3b interacts with Myc and decreases Myc levels. J. Biol. Chem. (0021-9258) 2014 imex curation Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. Have not really entered many causality statements as cell lines used are not the same for mRNA expression and ChIPs. Fig 9 - I have entered one statement here to last Experiment, - but the genes in the ChIps are not involved in possible statements, so remove if you dont think it appropriate to add. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es Only protein-protein interactions human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. K562/S cells;a K562 subclone able to grow attached to plastic. fportillo@iib.uam.es,leonj@unican.es Accepted 2015-MAR-13 by ORCHARD J. Biol. Chem. (0021-9258) 2014 imex curation Sin3b interacts with Myc and decreases Myc levels. Sin3b interacts with Myc and decreases Myc levels. J. Biol. Chem. (0021-9258) 2014 imex curation Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. Have not really entered many causality statements as cell lines used are not the same for mRNA expression and ChIPs. Fig 9 - I have entered one statement here to last Experiment, - but the genes in the ChIps are not involved in possible statements, so remove if you dont think it appropriate to add. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es Only protein-protein interactions rat-ur61 RAT UR61 pheochromocytoma cell ur61 UR61 -PC12/U7 -derived Rat pheochromocytoma cell line anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es Accepted 2015-MAR-13 by ORCHARD mouse NIH3T3 fibroblast cDNA library J. Biol. Chem. (0021-9258) 2014 imex curation Sin3b interacts with Myc and decreases Myc levels. Sin3b interacts with Myc and decreases Myc levels. J. Biol. Chem. (0021-9258) 2014 imex curation Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. Have not really entered many causality statements as cell lines used are not the same for mRNA expression and ChIPs. Fig 9 - I have entered one statement here to last Experiment, - but the genes in the ChIps are not involved in possible statements, so remove if you dont think it appropriate to add. The authors have stated that "The Myc cDNA of the constructs (depicted in Fig 3A and used in Fig 1 and 3) is human." and that Sin3a- myc; as used in Figure 5 is of Murine origin. fportillo@iib.uam.es,leonj@unican.es Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Garcia-Sanz P., Quintanilla A., Lafita M.C., Moreno-Bueno G., García-Gutierrez L., Tabor V., Varela I., Shiio Y., Larsson L.G., Portillo F., Leon J. Affinomics - Interactions curated for the Affinomics consortium. fportillo@iib.uam.es,leonj@unican.es Accepted 2015-MAR-13 by ORCHARD mouse NIH3T3 fibroblast cDNA library J. Biol. Chem. (0021-9258) 2014 imex curation s5a1_human_gene 3-oxo-5-alpha-steroid 4-dehydrogenase 1 SRD5A1 SR type 1 Steroid 5-alpha-reductase 1 gene gene human Homo sapiens Human hes1_human_gene HES1 HUMAN GENE gene gene human Homo sapiens Human mad1_human Max dimerization protein 1 MAD Protein MAD MXD1 protein protein human Homo sapiens Human MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSKKNNSSSRSTHNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSSSSVSDSDERGSMQSLGSDEGYSSTSIKRIKLQDSHKACLGL DIP protein Q05195 original sequence version: 72 B39FAEBFD708B6AB sin3b_human Paired amphipathic helix protein Sin3b Transcriptional corepressor Sin3b Histone deacetylase complex subunit Sin3b SIN3B KIAA0700 protein protein human Homo sapiens Human MAHAGGGSGGSGAGGPAGRGLSGARWGRSGSAGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLTSQENSHNHGDGAEDFKQQVPYKEDKPQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLNTRGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGPCEMHSVQKNEHDKTPEHSRKRSRPSLLRPVSAPAKKKMKLRGTKDLSIAAVGKYGTLQEFSFFDKVRRVLKSQEVYENFLRCIALFNQELVSGSELLQLVSPFLGKFPELFAQFKSFLGVKELSFAPPMSDRSGDGISREIDYASCKRIGSSYRALPKTYQQPKCSGRTAICKELDHWTLLQGSWTDDYCMSKFKNTCWIPGYSAGVLNDTWVSFPSWSEDSTFVSSKKTPYEEQLHRCEDERFELDVVLETNLATIRVLESVQKKLSRMAPEDQEKFRLDDSLGGTSEVIQRRAIYRIYGDKAPEIIESLKKNPVTAVPVVLKRLKAKEEEWREAQQGFNKIWREQYEKAYLKSLDHQAVNFKQNDTKALRSKSLLNEIESVYDEHQEQHSEGRSAPSSEPHLIFVYEDRQILEDAAALISYYVKRQPAIQKEDQGTIHQLLHQFVPSLFFSQQLDLGASEESADEDRDSPQGQTTDPSERKKPAPGPHSSPPEEKGAFGDAPATEQPPLPPPAPHKPLDDVYSLFFANNNWYFFLRLHQTLCSRLLKIYRQAQKQLLEYRTEKEREKLLCEGRREKGSDPAMELRLKQPSEVELEEYYPAFLDMVRSLLEGSIDPTQYEDTLREMFTIHAYVGFTMDKLVQNIARQLHHLVSDDVCLKVVELYLNEKKRGAAGGNLSSRCVRAARETSYQWKAERCMADENCFKVMFLQRKGQVIMTIELLDTEEAQTEDPVEVQHLARYVEQYVGTEGASSSPTEGFLLKPVFLQRNLKKFRRRWQSEQARALRGEARSSWKRLVGVESACDVDCRFKLSTHKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHQHFEEWHSRWLEDNVTVEAASLVQDWLMGEEDEDMVPCKTLCETVHVHGLPVTRYRVQYSRRPASP 03D3B24AF1CF40B6 nucl_human_gene Nucleolin NCL Protein C23 gene gene human Homo sapiens Human myc_rat Myc proto-oncogene protein Myc Transcription factor p64 Proto-oncogene c-Myc protein protein rat Rattus norvegicus (Rat) Rat MPLNVSFANRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQDLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSSSSDSLLSSESSPRATPEPLVLHEETPPTTSSDSEEEQDDEEEIDVVSVEKRQPPAKRSESGSSPSRGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQADEHKLISEKDLLRKRREQLKHKLEQLRNSGA Participates in the regulation of gene transcription. Binds DNA both in a non-specific manner and also specifically to recognizes the core sequence 5'-CAC[GA]TG-3'. Seems to activate the transcription of growth-related genes Overexpression of C-Myc is implicated in the etiology of a variety of hematopoietic tumors mint 7547DCCECF74554F ldha_human_gene Human L-lactate dehydrogenase A chain gene gene gene human Homo sapiens Human myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA DIP protein P01106 original sequence version: 195 DIP protein P01106 original sequence version: 196 DIP protein P01106 original sequence version: 148 DIP protein P01106-1 original sequence version: 161 DIP protein P01106 original sequence version: 182 DIP protein P01106 original sequence version: 197 DIP protein P01106-1 original sequence version: 208 DIP protein P01106 original sequence version: 121 DIP protein P01106-1 original sequence version: 144 DIP protein P01106 original sequence version: 144 ED5C028029A4C5D1 sin3a_mouse Paired amphipathic helix protein Sin3a Sin3a Kiaa4126 Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein mouse Mus musculus Mouse MKRRLDDQESPVYAAQQRRIPGSTEAFSHQHRVLAPAPPVYEAVSETMQSATGIQYSVAPNYQVSAVPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSSQSAPTPAQPAPQPTAAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHSGTGATPPVKKKPKLMSLKESSMADASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLESFPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAPKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEVCVQVTDLYLAENNNGATGGQLNSQTSRSLLESAYQRKAEQLMSDENCFKLMFIQSQGQVQLTVELLDTEEENSDDPVEAERWSDYVERYMSSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVESLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP DIP protein Q60520 original sequence version: 144 DIP protein Q60520 original sequence version: 106 DIP protein Q60520 original sequence version: 115 DIP protein Q60520 original sequence version: 158 80FE378F62ED7CB3 max_human Protein max MAX BHLHD4 Class D basic helix-loop-helix protein 4 Myc-associated factor X protein protein human Homo sapiens Human MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS DIP protein P61244 original sequence version: 132 DIP protein P61244 original sequence version: 128 DIP protein P61244 original sequence version: 150 DIP protein P61244 original sequence version: 120 EB10F3137727A56F hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 cdk4_human_gene Cyclin-dependent kinase 4 Cell division protein kinase 4 CDK4 PSK-J3 gene gene human Homo sapiens Human sin3b_mouse Paired amphipathic helix protein Sin3b Transcriptional corepressor Sin3b Histone deacetylase complex subunit Sin3b Sin3b Kiaa0700 protein protein mouse Mus musculus Mouse MAHAGSGGSAGRGFGGSRWGRSGSGGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLSSQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPVSAPAKKKMKLRGTKDLSIAAVGKYGTLQEFSFFDKVRRVLKSQEVYENFLRCIALFNQELVSGSELLQLVSPFLGKFPELFAQFKSFLGVKELSFAPPMSDRSGDGISREIDYASCKRIGSSYRALPKTYQQPKCSGRTAICKEVLNDTWVSFPSWSEDSTFVSSKKTPYEEQLHRCEDERFELDVVLETNLATIRVLESVQKKLSRMAPEDQEKLRLDDCLGGTSEVIQRRAIHRIYGDKAPEVIESLKRNPATAVPVVLKRLKAKEEEWREAQQGFNKIWREQYEKAYLKSLDHQAVNFKQNDTKALRSKSLLNEIESVYDEHQEQHSEGRSAPSSEPHLIFVYEDRQILEDAAALISYYVKRQPAIQKEDQGTIRQLLHRFLPSLFFSQQCPGTSDDSADERDRDRDSAEPERRRPTDEKPPADASPEPPKVLDDVYSLFFANNNWYFFLRLHQTLCARLLKIYRQAQKQLLEHRREQEREQLLCEGRREKAADPAMELRLKQPSEVELEEYYPAFLDMVRSLLEGSIDPTQYEDTLREMFTIHAYIGFTMDKLVQNIARQLHHLVSDDVCLKVVELYLNEQQRGAAGGNLSSRCVRAARETSYQWKAERCMADENCFKVMFLQRRGQVIMTIELLDTEEAQTEDPVEVQHLARYVEQYVGSEGASSSSTEGFLLKPVFLQRNLKKFRRWQCEQVRAMRGEAKSSWKRLMGVESACDVDCRFRLGTHKMVFIVNSEDYMYRRGTLCRAKQVQPLVLLRHHRHFEEWHGRWLEDNVTVAAAGLVQDWLMGEEEEDMVPCKTLCETAHVHGLPVTRYRVQYSRRPASP A73F6DFC11EBA256 pyr1_human_gene PYR1_HUMAN_GENE/CAD gene gene human Homo sapiens Human b0bnj0_rat Sin3b rCG_38713 protein protein rat Rattus norvegicus (Rat) Rat MAHAGGGGSAGRGFGGSRWGRSGSGGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLSNQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGSCEMNSAQKNEEKSLEHKKRSRPSLLRPVSAPAKVGLQLKCAVVWFGYCTAEE 7D5E0C5ED947968B myc-sin3b 11 19 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1A sin3b-myc 1 19 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 24 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1B myc-sin3b-1 1 24 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 19 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 1C, 3A myc-sin3b-2 4 24 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 19 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true ecoli Escherichia coli (strain K12) physical association physical association 1D sin3b-myc-1 4 19 unspecified role unspecified role prey prey his or flag tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 24 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 1E Origene's web site (Supplier of myc) lists two myc proteins, both human; one with an N terminal His tag (expressed in E.coli), the other with a C terminal FLAG tag (expressed in 293 cells). myc-sin3b-3 5 15 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait physical association physical association 2A myc-sin3b-5 9 19 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component colocalization colocalization 2B TPA (PMA) -in this instance, used to decrease Myc expression. myc-sin3b-6 8 15 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 2D-1 TPA (PMA) -in this instance, used to decrease Myc expression. myc-max-15 8 19 unspecified role unspecified role neutral component neutral component 21 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 2D-2 TPA (PMA) -in this instance, used to decrease Myc expression. max-mad-1 8 15 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 2D-3 sin3b-myc-2 10 24 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 19 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true physical association physical association 3B myc-sin3b-7 10 19 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 24 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true physical association physical association 3B myc-sin3b-8 6 17 unspecified role unspecified role bait bait 26 unspecified role unspecified role prey prey physical association physical association 3B-RHS myc-sin3b-9 1 20 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 19 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true physical association physical association 5A myc-hdac1 1 22 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true 24 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true association association 6C myc-hdac1-1 5 22 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association 6C-RHS sin3b-hdac1-1 5 22 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey association association 6C-RHS-2 myc-ncl 7 19 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 7B-1 Tetracycline -represses Myc expression myc-ncl-1 7 15 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 7B-2 myc-ncl-2 7 23 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait association association 7B-3 Tetracycline -represses Myc expression sin3b-ncl 7 23 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait association association 7B-4 myc-cdk4 7 19 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 7B-5 Tetracycline -represses Myc expression myc-srd5a1 7 15 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 7B-6 Tetracycline -represses Myc expression myc-ncl-3 7 13 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait association association 7B-7 Tetracycline -represses Myc expression sin3b-cdk4 7 13 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait association association 7B-8 myc-ldha-2 2 18 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role bait bait association association 7D-1 myc-ldha-1 2 19 unspecified role unspecified role bait bait 25 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 7D-2 sin3b-ldha-1 3 15 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true association association 7D-1 O75182 decreases expression at protein level of P01106 sin3b-myc-3 3 15 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey e_box_promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined true association association 7D-2