IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Galanin receptor 2-neuropeptide Y Y1 receptor interactions in the amygdala lead to increased anxiolytic actions. Galanin receptor 2-neuropeptide Y Y1 receptor interactions in the amygdala lead to increased anxiolytic actions. Brain Struct Funct (1863-2653) 2014 imex curation Narváez M., Millón C., Borroto-Escuela D., Flores-Burgess A., Santín L., Parrado C., Gago B., Puigcerver A., Fuxe K., Narváez J.A., Díaz-Cabiale Z., Díaz-Cabiale Z. Affinomics - Interactions curated for the Affinomics consortium. zaida@uma.es 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions rat-brain Rattus norvegicus brain brain Brain [cerebrum] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Narváez M., Millón C., Borroto-Escuela D., Flores-Burgess A., Santín L., Parrado C., Gago B., Puigcerver A., Fuxe K., Narváez J.A., Díaz-Cabiale Z., Díaz-Cabiale Z. Affinomics - Interactions curated for the Affinomics consortium. methods section says "Rat- brain" - presumably the rat has a small enough brain to not be more specific for PLA than that; originally I had thought that a brain region was used - "amygdala", from looking at image and associated text. zaida@uma.es Accepted 2015-FEB-19 by ORCHARD Brain Struct Funct (1863-2653) 2014 Only protein-protein interactions imex curation Galanin receptor 2-neuropeptide Y Y1 receptor interactions in the amygdala lead to increased anxiolytic actions. Galanin receptor 2-neuropeptide Y Y1 receptor interactions in the amygdala lead to increased anxiolytic actions. Brain Struct Funct (1863-2653) 2014 imex curation Narváez M., Millón C., Borroto-Escuela D., Flores-Burgess A., Santín L., Parrado C., Gago B., Puigcerver A., Fuxe K., Narváez J.A., Díaz-Cabiale Z., Díaz-Cabiale Z. Affinomics - Interactions curated for the Affinomics consortium. zaida@uma.es 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions rat-amygdala Rattus norvegicus amygdala amygdala confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Narváez M., Millón C., Borroto-Escuela D., Flores-Burgess A., Santín L., Parrado C., Gago B., Puigcerver A., Fuxe K., Narváez J.A., Díaz-Cabiale Z., Díaz-Cabiale Z. Affinomics - Interactions curated for the Affinomics consortium. zaida@uma.es Accepted 2015-FEB-19 by ORCHARD Brain Struct Funct (1863-2653) 2014 Only protein-protein interactions imex curation Galanin receptor 2-neuropeptide Y Y1 receptor interactions in the amygdala lead to increased anxiolytic actions. Galanin receptor 2-neuropeptide Y Y1 receptor interactions in the amygdala lead to increased anxiolytic actions. Brain Struct Funct (1863-2653) 2014 imex curation Narváez M., Millón C., Borroto-Escuela D., Flores-Burgess A., Santín L., Parrado C., Gago B., Puigcerver A., Fuxe K., Narváez J.A., Díaz-Cabiale Z., Díaz-Cabiale Z. Affinomics - Interactions curated for the Affinomics consortium. zaida@uma.es 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Narváez M., Millón C., Borroto-Escuela D., Flores-Burgess A., Santín L., Parrado C., Gago B., Puigcerver A., Fuxe K., Narváez J.A., Díaz-Cabiale Z., Díaz-Cabiale Z. Affinomics - Interactions curated for the Affinomics consortium. I assume GALR2 must be endogenous as no clone/cDNA/construct is mentioned for this protein; the text is ambiguous however? zaida@uma.es Accepted 2015-FEB-19 by ORCHARD Brain Struct Funct (1863-2653) 2014 Only protein-protein interactions imex curation npy1r_human Neuropeptide Y receptor type 1 NPY1R NPYR NPYY1 protein protein human Homo sapiens Human MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI 582B0DDB04490316 galr2_human Galanin receptor type 2 GALR2 GALNR2 protein protein human Homo sapiens Human MNVSGCPGAGNASQAGGGGGWHPEAVIVPLLFALIFLVGTVGNTLVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWSAPRRRAMDICTFVFSYLLPVLVLGLTYARTLRYLWRAVDPVAAGSGARRAKRKVTRMILIVAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRTICAGLLGRAPGRASGRVCAAARGTHSGSVLERESSDLLHMSEAAGALRPCPGASQPCILEPCPGPSWQGPKAGDSILTVDVA C2D2FCB93E53C47E galr2_rat Galanin receptor type 2 Galr2 Galnr2 protein protein rat Rattus norvegicus (Rat) Rat MNGSGSQGAENTSQEGGSGGWQPEAVLVPLFFALIFLVGTVGNALVLAVLLRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYRQSQLANLTVCHPAWSAPRRRAMDLCTFVFSYLLPVLVLSLTYARTLRYLWRTVDPVTAGSGSQRAKRKVTRMIIIVAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRKICAGLLRPAPRRASGRVSILAPGNHSGSMLEQESTDLTQVSEAAGPLVPPPALPNCTASSRTLDPAC 5E7B67B35A54AB6E npy1r_rat Neuropeptide Y receptor type 1 Npy1r FC5 protein protein rat Rattus norvegicus (Rat) Rat MNSTLFSRVENYSVHYNVSENSPFLAFENDDCHLPLAVIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAVMCLPFTFVYTLMDHWVFGETMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYIGITVIWVLAVASSLPFVIYQILTDEPFQNVSLAAFKDKYVCFDKFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKIRDSKYRSSETKRINVMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKISMNDNEKI 1D6AA038065C07C3 galr2-npy1r 1 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Figure 3 Positive results were seen in cells of the ITC nucleus;the intercalated (ITC) cells of the amygdala are a group of GABAergic neurons situated between the basolateral and central nuclei of the amygdala that are important for inhibitory control over the amygdala. galr2-npy1r-1 2 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization Supp Figure 4 Positive results were seen in cells of the ITC nucleus;the intercalated (ITC) cells of the amygdala are a group of GABAergic neurons situated between the basolateral and central nuclei of the amygdala that are important for inhibitory control over the amygdala. galr2-npy1r-2 3 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction Supp Figure 5