IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Heparan sulfates mediate the interaction between platelet endothelial cell adhesion molecule-1 (PECAM-1) and the Gαq/11 subunits of heterotrimeric G proteins. Heparan sulfates mediate the interaction between platelet endothelial cell adhesion molecule-1 (PECAM-1) and the Gαq/11 subunits of heterotrimeric G proteins. J. Biol. Chem. (0021-9258) 2014 imex curation dela Paz N.G., Melchior B., Shayo F.Y., Frangos J.A. Affinomics - Interactions curated for the Affinomics consortium. ndelapaz@ljbi.org 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot dela Paz N.G., Melchior B., Shayo F.Y., Frangos J.A. Affinomics - Interactions curated for the Affinomics consortium. ndelapaz@ljbi.org Accepted 2014-DEC-09 by ORCHARD J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Heparan sulfates mediate the interaction between platelet endothelial cell adhesion molecule-1 (PECAM-1) and the Gαq/11 subunits of heterotrimeric G proteins. Heparan sulfates mediate the interaction between platelet endothelial cell adhesion molecule-1 (PECAM-1) and the Gαq/11 subunits of heterotrimeric G proteins. J. Biol. Chem. (0021-9258) 2014 imex curation dela Paz N.G., Melchior B., Shayo F.Y., Frangos J.A. Affinomics - Interactions curated for the Affinomics consortium. ndelapaz@ljbi.org 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hcaec human coronary artery endothelial cells hcaec human cardiac artery endothelial cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection dela Paz N.G., Melchior B., Shayo F.Y., Frangos J.A. Affinomics - Interactions curated for the Affinomics consortium. Results from Figure 2, 3A have not been entered due to lack of antibody specificity (GNAQ and GNA11 antibody). In figure 4 cells were counterstained with FITC-conjugated anti-PECAM-1 to identify the cell-cell junctions. ndelapaz@ljbi.org Accepted 2014-DEC-09 by ORCHARD J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation gpc1_human Glypican-1 GPC1 protein protein human Homo sapiens Human MELRARGWWLLCAAAALVACARGDPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHPQLLLPDDYLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRGKLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQDASDDGSGSGSGDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTFLLPLLLFLALTVARPRWR Cell surface proteoglycan that bears heparan sulfate mint 16553B56080A83C8 peca1_human Platelet endothelial cell adhesion molecule PECA1 EndoCAM GPIIA' PECAM1 protein protein human Homo sapiens Human MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFADVSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTTAEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKREKNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHISPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHNRHGNKAVYSVMAMVEHSGNYTCKVESSRISKVSSIVVNITELFSKPELESSFTHLDQGERLNLSCSIPGAPPANFTIQKEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFEVIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREKEGKPFYQMTSNATQAFWTKQKASKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT 9D531D2DDCCB7F92 sdc4_human Syndecan-4 SDC4 Amphiglycan Ryudocan core protein protein protein human Homo sapiens Human MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYA DIP protein P31431 original sequence version: 87 DIP protein P31431-1 original sequence version: 134 8229AA2733F77A10 sdc1_human Syndecan-1 SDC1 SDC protein protein human Homo sapiens Human MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQLLTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEATPRPRETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHTEDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAVEPDRRNQSPVDQGATGASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQKPTKQEEFYA DIP protein P18827 original sequence version: 77 DIP protein P18827 original sequence version: 127 8E9EF4A57F5FDBD0 ackr3_human Atypical chemokine receptor 3 ACKR3 C-X-C chemokine receptor type 7 CMKOR1 CXCR7 Chemokine orphan receptor 1 G-protein coupled receptor 159 G-protein coupled receptor RDC1 homolog GPR159 RDC1 protein protein human Homo sapiens Human MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK A863EC1AFB5B158B gnaq_human Guanine nucleotide-binding protein G(q) subunit alpha GNAQ GAQ Guanine nucleotide-binding protein alpha-q protein protein human Homo sapiens Human MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV DIP protein P50148 original sequence version: 154 6F69C4F617DFA7C7 cxcr4_human C-X-C chemokine receptor type 4 Stromal cell-derived factor 1 receptor Fusin Leukocyte-derived seven transmembrane domain receptor LCR1 FB22 NPYRL HM89 CXCR4 Lipopolysaccharide-associated protein 3 protein protein human Homo sapiens Human MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS DIP protein P61073 original sequence version: 80 8C8476A186786B83 pecam1-gnaq 1 8 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range P16284:p.[Lys176Ala;Arg179Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:24:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys176ala,arg179ala' Tue Jun 30 15:44:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys176Ala;Arg179Ala]' P16284:p.Lys176Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 16:54:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys176ala' Tue Jun 30 19:18:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys176Ala' P16284:p.Arg179Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 14:42:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg179ala' Tue Jun 30 17:52:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg179Ala' P16284:p.[Lys176Ala;Arg179Ala;His239Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain K A Fri Jul 22 11:13:36 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg179ala,his239ala,lys176ala' Wed May 02 16:23:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys176ala,arg179ala,his239ala' Tue Jun 30 18:00:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys176Ala;Arg179Ala;His239Ala]' P16284:p.[Lys176Ala;Arg179Ala;His239Ala;Lys255Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain H A certain certain sequence position certain certain certain sequence position certain K A Wed May 02 17:11:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys176ala,arg179ala,his239ala,lys255ala' Tue Jun 30 18:43:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys176Ala;Arg179Ala;His239Ala;Lys255Ala]' physical association physical association Surfen ( a small molecule heparan sulfate antagonist) Heparinase III 1A/B/C/D Heparin pecam1-sdc1 2 4 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 4B pecam1-sdc1-1 2 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3C pecam1-sdc4 2 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3D cxcr4-pecam1 2 4 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3B, 4A pecam1-sdc1-2 2 7 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 4C