IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1. Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1. J. Biol. Chem. (0021-9258) 2014 imex curation Li X., Xu M., Wang F., Kohan A.B., Haas M.K., Yang Q., Lou D., Obici S., Davidson W.S., Tso P. Cardiac - Interactions involving cardiac related proteins Diabetes - Interactions investigated in the context of Diabetes Affinomics - Interactions curated for the Affinomics consortium. tsopp@ucmail.uc.edu 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Li X., Xu M., Wang F., Kohan A.B., Haas M.K., Yang Q., Lou D., Obici S., Davidson W.S., Tso P. Cardiac - Interactions involving cardiac related proteins tsopp@ucmail.uc.edu Accepted 2014-OCT-15 by ORCHARD J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1. Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1. J. Biol. Chem. (0021-9258) 2014 imex curation Li X., Xu M., Wang F., Kohan A.B., Haas M.K., Yang Q., Lou D., Obici S., Davidson W.S., Tso P. Cardiac - Interactions involving cardiac related proteins Diabetes - Interactions investigated in the context of Diabetes Affinomics - Interactions curated for the Affinomics consortium. tsopp@ucmail.uc.edu 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Li X., Xu M., Wang F., Kohan A.B., Haas M.K., Yang Q., Lou D., Obici S., Davidson W.S., Tso P. Cardiac - Interactions involving cardiac related proteins tsopp@ucmail.uc.edu Accepted 2014-OCT-15 by ORCHARD J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1. Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1. J. Biol. Chem. (0021-9258) 2014 imex curation Li X., Xu M., Wang F., Kohan A.B., Haas M.K., Yang Q., Lou D., Obici S., Davidson W.S., Tso P. Cardiac - Interactions involving cardiac related proteins Diabetes - Interactions investigated in the context of Diabetes Affinomics - Interactions curated for the Affinomics consortium. tsopp@ucmail.uc.edu 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Li X., Xu M., Wang F., Kohan A.B., Haas M.K., Yang Q., Lou D., Obici S., Davidson W.S., Tso P. Cardiac - Interactions involving cardiac related proteins tsopp@ucmail.uc.edu Accepted 2014-OCT-15 by ORCHARD rat liver cDNA library J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1. Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1. J. Biol. Chem. (0021-9258) 2014 imex curation Li X., Xu M., Wang F., Kohan A.B., Haas M.K., Yang Q., Lou D., Obici S., Davidson W.S., Tso P. Cardiac - Interactions involving cardiac related proteins Diabetes - Interactions investigated in the context of Diabetes Affinomics - Interactions curated for the Affinomics consortium. tsopp@ucmail.uc.edu 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Li X., Xu M., Wang F., Kohan A.B., Haas M.K., Yang Q., Lou D., Obici S., Davidson W.S., Tso P. Cardiac - Interactions involving cardiac related proteins tsopp@ucmail.uc.edu Accepted 2014-OCT-15 by ORCHARD J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1. Apolipoprotein A-IV reduces hepatic gluconeogenesis through nuclear receptor NR1D1. J. Biol. Chem. (0021-9258) 2014 imex curation Li X., Xu M., Wang F., Kohan A.B., Haas M.K., Yang Q., Lou D., Obici S., Davidson W.S., Tso P. Cardiac - Interactions involving cardiac related proteins Diabetes - Interactions investigated in the context of Diabetes Affinomics - Interactions curated for the Affinomics consortium. tsopp@ucmail.uc.edu 12-Nov-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Li X., Xu M., Wang F., Kohan A.B., Haas M.K., Yang Q., Lou D., Obici S., Davidson W.S., Tso P. Cardiac - Interactions involving cardiac related proteins The identity of "Glc-6-Pase" was determined by blatting primers - for mouse, in this publication, and for human, using those given in Ref. 17. tsopp@ucmail.uc.edu Accepted 2014-OCT-15 by ORCHARD J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation g6pc_human_gene Glucose-6-phosphatase gene gene gene human Homo sapiens Human nr1d1_human Nuclear receptor subfamily 1 group D member 1 NR1D1 EAR1 HREV THRAL Rev-erbA-alpha V-erbA-related protein 1 protein protein human Homo sapiens Human MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTSNITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQAPSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPMNMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNNMHSEKLLSFRVDAQ DIP protein P20393 original sequence version: 124 DIP protein P20393 original sequence version: 162 DIP protein P20393 original sequence version: 132 67C71758E166508A apoa4_human Apolipoprotein A-IV APOA4 Apolipoprotein A4 protein protein human Homo sapiens Human MFLKAVVLTLALVAVAGARAEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNALFQDKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVSTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLES DIP protein P06727 original sequence version: 143 19307A196CAE0A4A apoa4_rat Apolipoprotein A-IV Apoa4 Apolipoprotein A4 protein protein rat Rattus norvegicus (Rat) Rat MFLKAVVLTVALVAITGTQAEVTSDQVANVMWDYFTQLSNNAKEAVEQLQKTDVTQQLNTLFQDKLGNINTYADDLQNKLVPFAVQLSGHLTKETERVREEIQKELEDLRANMMPHANKVSQMFGDNVQKLQEHLRPYATDLQAQINAQTQDMKRQLTPYIQRMQTTIQDNVENLQSSMVPFANELKEKFNQNMEGLKGQLTPRANELKATIDQNLEDLRSRLAPLAEGVQEKLNHQMEGLAFQMKKNAEELQTKVSTNIDQLQKNLAPLVEDVQSKLKGNTEGLQKSLEDLNKQLDQQVEVFRRAVEPLGDKFNMALVQQMEKFRQQLGSDSGDVESHLSFLEKNLREKVSSFMSTLQKKGSPDQPLALPLPEQVQEQVQEQVQPKPLES 24095004A809201D nr1d1_rat Nuclear receptor subfamily 1 group D member 1 Nr1d1 Rev-erbA-alpha V-erbA-related protein 1 protein protein rat Rattus norvegicus (Rat) Rat MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDSSNGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGTVPPSLSDDSSPSSASSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKGTSNITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQNAMNLANNQLSSLCPLETSPAPHPTSGSVGPSPPPAPAPTPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTYAHDKLGTSPGNFNANHASGSPPATTPQCWESQGCPSTPNDNNLLAAQRHNEALNGLRQGPSSYPPTWPSGPAHHSCHQPNSNGHRLCPTHVYSAPEGKAPANGLRQGNTKNVLLACPMNMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLNAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSGMENSASVEQLQKTLLRALRALVLKNRPSETSRFTKLLLKLPDLRTLNNMHSEKLLSFRVDAQ 3CC44132F82A25F6 apoa4-nr1d1 3 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 15 13 physical association physical association No figure apoa4-nr1d1-1 2 8 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component colocalization colocalization 4A apoa4-nr1d1-2 1 8 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 4B apoa4-nr1d1-4 4 8 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey physical association physical association 5A apoa4-g6pc 5 6 unspecified role unspecified role prey prey retinoid-related_orphan_receptor_alpha_response_element_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey association association 5A P06727 and P20393 decreases expression at RNA level of ENSG00000131482. P20393 decreases expression at RNA level of ENSG00000131482. P20393 is required for P06727 to decrease expression at RNA level of ENSG00000131482 and ENSG00000100889. P06727 increases expression at RNA level of ENSG00000126368. P06727 increases expression at protein level of ENSG00000126368. apoa4-g6pc-1 5 8 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey retinoid-related_orphan_receptor_alpha_response_element_promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 5A P06727 decreases expression at RNA level of ENSG00000131482. P06727 decreases expression at RNA level of ENSG00000100889. P06727 and P20393 decreases expression at RNA level of ENSG00000131482. P06727 increases expression at RNA level of ENSG00000126368. P06727 increases expression at protein level of ENSG00000126368.