IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER. STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER. J. Cell. Sci. (0021-9533) 2013 imex curation Alpy F., Rousseau A., Schwab Y., Legueux F., Stoll I., Wendling C., Spiegelhalter C., Kessler P., Mathelin C., Rio M.C., Levine T.P., Tomasetto C. Affinomics - Interactions curated for the Affinomics consortium. Fabien.Alpy@igbmc.fr 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Alpy F., Rousseau A., Schwab Y., Legueux F., Stoll I., Wendling C., Spiegelhalter C., Kessler P., Mathelin C., Rio M.C., Levine T.P., Tomasetto C. Affinomics - Interactions curated for the Affinomics consortium. Fabien.Alpy@igbmc.fr Accepted 2014-SEP-26 by ORCHARD J. Cell. Sci. (0021-9533) 2013 Only protein-protein interactions imex curation STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER. STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER. J. Cell. Sci. (0021-9533) 2013 imex curation Alpy F., Rousseau A., Schwab Y., Legueux F., Stoll I., Wendling C., Spiegelhalter C., Kessler P., Mathelin C., Rio M.C., Levine T.P., Tomasetto C. Affinomics - Interactions curated for the Affinomics consortium. Fabien.Alpy@igbmc.fr 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Alpy F., Rousseau A., Schwab Y., Legueux F., Stoll I., Wendling C., Spiegelhalter C., Kessler P., Mathelin C., Rio M.C., Levine T.P., Tomasetto C. Affinomics - Interactions curated for the Affinomics consortium. Figs 7D/E +Supp 3 not added as no interaction is shown with LAMP1 - subcellular marker only. LAMP1 labeling was performed after PLA staining. Fabien.Alpy@igbmc.fr Accepted 2014-SEP-26 by ORCHARD J. Cell. Sci. (0021-9533) 2013 Only protein-protein interactions imex curation STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER. STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER. J. Cell. Sci. (0021-9533) 2013 imex curation Alpy F., Rousseau A., Schwab Y., Legueux F., Stoll I., Wendling C., Spiegelhalter C., Kessler P., Mathelin C., Rio M.C., Levine T.P., Tomasetto C. Affinomics - Interactions curated for the Affinomics consortium. Fabien.Alpy@igbmc.fr 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Alpy F., Rousseau A., Schwab Y., Legueux F., Stoll I., Wendling C., Spiegelhalter C., Kessler P., Mathelin C., Rio M.C., Levine T.P., Tomasetto C. Affinomics - Interactions curated for the Affinomics consortium. FRET-FLIM (Fluorescence-lifetime imaging microscopy) :- a shortening of donor lifetime is observed. Fabien.Alpy@igbmc.fr Accepted 2014-SEP-26 by ORCHARD J. Cell. Sci. (0021-9533) 2013 Only protein-protein interactions imex curation STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER. STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER. J. Cell. Sci. (0021-9533) 2013 imex curation Alpy F., Rousseau A., Schwab Y., Legueux F., Stoll I., Wendling C., Spiegelhalter C., Kessler P., Mathelin C., Rio M.C., Levine T.P., Tomasetto C. Affinomics - Interactions curated for the Affinomics consortium. Fabien.Alpy@igbmc.fr 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Alpy F., Rousseau A., Schwab Y., Legueux F., Stoll I., Wendling C., Spiegelhalter C., Kessler P., Mathelin C., Rio M.C., Levine T.P., Tomasetto C. Affinomics - Interactions curated for the Affinomics consortium. For Figure 2:-methods section state that anti-GFP antibody was used - OR anti-VAP-A - I cannot see that GFP/tag fluorescence was used for Participant Detection. Fabien.Alpy@igbmc.fr Accepted 2014-SEP-26 by ORCHARD J. Cell. Sci. (0021-9533) 2013 Only protein-protein interactions imex curation STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER. STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER. J. Cell. Sci. (0021-9533) 2013 imex curation Alpy F., Rousseau A., Schwab Y., Legueux F., Stoll I., Wendling C., Spiegelhalter C., Kessler P., Mathelin C., Rio M.C., Levine T.P., Tomasetto C. Affinomics - Interactions curated for the Affinomics consortium. Fabien.Alpy@igbmc.fr 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Alpy F., Rousseau A., Schwab Y., Legueux F., Stoll I., Wendling C., Spiegelhalter C., Kessler P., Mathelin C., Rio M.C., Levine T.P., Tomasetto C. Affinomics - Interactions curated for the Affinomics consortium. Cross-linking using 'Lomant's reagent'- (DSP- Dithiobis(succinimidyl propionate) Fabien.Alpy@igbmc.fr Accepted 2014-SEP-26 by ORCHARD J. Cell. Sci. (0021-9533) 2013 Only protein-protein interactions imex curation str3n_human STARD3 N-terminal-like protein STARD3NL MENTHO MLN64 N-terminal domain homolog UNQ855/PRO1864 protein protein human Homo sapiens Human MNHLPEDMENALTGSQSSHASLRNIHSINPTQLMARIESYEGREKKGISDVRRTFCLFVTFDLLFVTLLWIIELNVNGGIENTLEKEVMQYDYYSSYFDIFLLAVFRFKVLILAYAVCRLRHWWAIALTTAVTSAFLLAKVILSKLFSQGAFGYVLPIISFILAWIETWFLDFKVLPQEAEEENRLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL AFB7DAE381983FB0 q14849-1 StAR-related lipid transfer protein 3 STARD3 CAB1 MLN64 Metastatic lymph node gene 64 protein Protein CAB1 START domain-containing protein 3 protein protein human Homo sapiens Human MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNTNTGIRKNLEQEIIQYNFKTSFFDIFVLAFFRFSGLLLGYAVLRLRHWWVIAVTTLVSSAFLIVKVILSELLSKGAFGYLLPIVSFVLAWLETWFLDFKVLPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGARA 8EBFBAF013CFDC7E star3_human StAR-related lipid transfer protein 3 STARD3 CAB1 MLN64 Metastatic lymph node gene 64 protein Protein CAB1 START domain-containing protein 3 protein protein human Homo sapiens Human MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWIIELNTNTGIRKNLEQEIIQYNFKTSFFDIFVLAFFRFSGLLLGYAVLRLRHWWVIAVTTLVSSAFLIVKVILSELLSKGAFGYLLPIVSFVLAWLETWFLDFKVLPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGARA 8EBFBAF013CFDC7E vapb_human Vesicle-associated membrane protein-associated protein B/C VAPB UNQ484/PRO983 protein protein human Homo sapiens Human MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLSTRLLALVVLFFIVGVIIGKIAL DIP protein O95292 original sequence version: 141 22AEEF9EC7FC0B3F vapa_human Vesicle-associated membrane protein-associated protein A VAPA VAP33 33 kDa VAMP-associated protein protein protein human Homo sapiens Human MASASGAMAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL DIP protein Q9P0L0 original sequence version: 136 DIP protein Q9P0L0 original sequence version: 130 68B603F3A9FA5475 o95772-1 STARD3 N-terminal-like protein STARD3NL MENTHO MLN64 N-terminal domain homolog UNQ855/PRO1864 protein protein human Homo sapiens Human MNHLPEDMENALTGSQSSHASLRNIHSINPTQLMARIESYEGREKKGISDVRRTFCLFVTFDLLFVTLLWIIELNVNGGIENTLEKEVMQYDYYSSYFDIFLLAVFRFKVLILAYAVCRLRHWWAIALTTAVTSAFLLAKVILSKLFSQGAFGYVLPIISFILAWIETWFLDFKVLPQEAEEENRLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL AFB7DAE381983FB0 stard3-vapa 4 10 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9P0L0:p.[Lys94Asp;Met96Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain M D Wed May 02 16:41:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys94asp,met96asp' Tue Jun 30 18:36:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys94Asp;Met96Asp]' 7 unspecified role unspecified role neutral component neutral component ffat_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain colocalization colocalization 2 stard3-vapa-1 1 10 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9P0L0:p.[Lys94Asp;Met96Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain M D Wed May 02 17:59:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys94asp,met96asp' Tue Jun 30 16:14:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys94Asp;Met96Asp]' 7 unspecified role unspecified role neutral component neutral component c_terminus mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Supplementary Material Movie 1+ 2 stard3-vapa-2 4 11 unspecified role unspecified role neutral component neutral component ffat_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role neutral component neutral component Q9P0L0:p.[Lys94Asp;Met96Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain M D Wed May 02 17:02:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys94asp,met96asp' Tue Jun 30 19:22:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys94Asp;Met96Asp]' n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization 2 stard3nl-vapa 4 6 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization Supp Fig 2A stard3nl-vapa-1 4 11 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role neutral component neutral component colocalization colocalization Supp Fig 2B/C, 3 stard3-vapa-3 4 7 unspecified role unspecified role neutral component neutral component ffat_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role neutral component neutral component O95292:p.[Lys87Asp;Met89Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain M D Wed May 02 17:16:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys87asp,met89asp' Tue Jun 30 17:18:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys87Asp;Met89Asp]' n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Supp Fig 2 D/F/H stard3nl-vapa-2 4 11 unspecified role unspecified role neutral component neutral component ffat_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O95292:p.[Lys87Asp;Met89Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain M D certain certain sequence position certain certain certain sequence position certain K D Fri Jul 22 11:08:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'met89asp,lys87asp' Wed May 02 18:23:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys87asp,met89asp' Tue Jun 30 19:44:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys87Asp;Met89Asp]' colocalization colocalization Supp Fig 2 E/G/I stard3-vapa-5 3 7 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept c_terminus mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role fluorescence donor fluorescence donor n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9P0L0:p.[Lys94Asp;Met96Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain M D Wed May 02 16:23:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys94asp,met96asp' Tue Jun 30 18:14:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys94Asp;Met96Asp]' proximity proximity close-contact colocalization neighbourhood interaction 3B stard3-vapa-6 5 10 unspecified role unspecified role neutral component neutral component n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9P0L0:p.[Lys94Asp;Met96Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain M D Wed May 02 14:43:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys94asp,met96asp' Tue Jun 30 19:55:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys94Asp;Met96Asp]' 11 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3G stard3-vapa-6 5 7 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ffat_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role neutral component neutral component n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9P0L0:p.[Lys94Asp;Met96Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain M D Wed May 02 18:24:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys94asp,met96asp' Tue Jun 30 18:22:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys94Asp;Met96Asp]' physical association physical association 3D/E stard3-vapa-6 5 7 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O95292:p.[Lys87Asp;Met89Asp] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K D certain certain sequence position certain certain certain sequence position certain M D Wed May 02 17:53:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys87asp,met89asp' Tue Jun 30 18:36:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys87Asp;Met89Asp]' physical association physical association 3F stard3-vapa-7 2 8 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 7 B/G PLA dots colocalized with the endosome/lysosome marker LAMP1. stard3-vapa-8 2 6 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 7 C/H, Supp Movie 7. PLA dots were typically excluded from the cell nucleus , and they colocalized with the endosome/lysosome marker LAMP1.