HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. PLoS Pathog. (1553-7366) 2013 imex curation Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. Virus - Publications including interactions involving viral proteins ryosuke@nih.go.jp 13-Jan-2014: Contacted by IntAct-Help. Human liver cDNA Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. Affinomics - Interactions curated for the Affinomics consortium. ryosuke@nih.go.jp Accepted 2013-DEC-03 by ORCHARD Human liver cDNA PLoS Pathog. (1553-7366) 2013 imex curation Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. PLoS Pathog. (1553-7366) 2013 imex curation Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. Virus - Publications including interactions involving viral proteins ryosuke@nih.go.jp 13-Jan-2014: Contacted by IntAct-Help. Human liver cDNA Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. complementation protein complementation assay PCA complementation tag fluorescence tag visualisation by fluorescence tag fluorescence Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. ryosuke@nih.go.jp Accepted 2013-DEC-03 by ORCHARD Human liver cDNA PLoS Pathog. (1553-7366) 2013 imex curation Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. PLoS Pathog. (1553-7366) 2013 imex curation Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. Virus - Publications including interactions involving viral proteins ryosuke@nih.go.jp 13-Jan-2014: Contacted by IntAct-Help. Human liver cDNA Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. Affinomics - Interactions curated for the Affinomics consortium. ryosuke@nih.go.jp Accepted 2013-DEC-03 by ORCHARD Human liver cDNA PLoS Pathog. (1553-7366) 2013 imex curation Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. PLoS Pathog. (1553-7366) 2013 imex curation Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. Virus - Publications including interactions involving viral proteins ryosuke@nih.go.jp 13-Jan-2014: Contacted by IntAct-Help. Human liver cDNA Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. Affinomics - Interactions curated for the Affinomics consortium. ryosuke@nih.go.jp Accepted 2013-DEC-03 by ORCHARD Human liver cDNA PLoS Pathog. (1553-7366) 2013 imex curation Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. PLoS Pathog. (1553-7366) 2013 imex curation Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. Virus - Publications including interactions involving viral proteins ryosuke@nih.go.jp 13-Jan-2014: Contacted by IntAct-Help. Human liver cDNA Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. Affinomics - Interactions curated for the Affinomics consortium. ryosuke@nih.go.jp Accepted 2013-DEC-03 by ORCHARD Human liver cDNA PLoS Pathog. (1553-7366) 2013 imex curation Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2. PLoS Pathog. (1553-7366) 2013 imex curation Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. Virus - Publications including interactions involving viral proteins ryosuke@nih.go.jp 13-Jan-2014: Contacted by IntAct-Help. Human liver cDNA Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Suzuki R., Matsuda M., Watashi K., Aizaki H., Matsuura Y., Wakita T., Suzuki T. Affinomics - Interactions curated for the Affinomics consortium. Affinomics - Interactions curated for the Affinomics consortium. ryosuke@nih.go.jp Accepted 2013-DEC-03 by ORCHARD Human liver cDNA PLoS Pathog. (1553-7366) 2013 imex curation q99ib8-pro_0000045598 Protease NS2 protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV YDAPVHGQIGVGLLILITLFTLTPGYKTLLGQCLWWLCYLLTLGEAMIQEWVPPMQVRGGRDGIAWAVTIFCPGVVFDITKWLLALLGPAYLLRAALTHVPYFVRAHALIRVCALVKQLAGGRYVQVALLALGRWTGTYIYDHLTPMSDWAASGLRDLAVAVEPIIFSPMEKKVIVWGAETAACGDILHGLPVSARLGQEILLGPADGYTSKGWKLL 814 1030 F9DC8D542CBB7DE4 q99ib8-pro_0000045597 Viroporin p7 protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV ALEKLVVLHAASAANCHGLLYFAIFFVAAWHIRGRVVPLTTYCLTGLWPFCLLLMALPRQAYA 751 813 7900201032E4E74B spcs1_human Signal peptidase complex subunit 1 SPCS1 SPC12 Microsomal signal peptidase 12 kDa subunit HSPC033 protein protein human Homo sapiens Human MARGGDTGCTGPSETSASGAAAIALPGLEGPATDAQCQTLPLTVLKSRSPSPRSLPPALSCPPPQPAMLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN 65F180938A9BEF1E q99ib8-pro_0000045596 Envelope glycoprotein E2 protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV GTTTVGGAVARSTNVIAGVFSHGPQQNIQLINTNGSWHINRTALNCNDSLNTGFLAALFYTNRFNSSGCPGRLSACRNIEAFRIGWGTLQYEDNVTNPEDMRPYCWHYPPKPCGVVPARSVCGPVYCFTPSPVVVGTTDRRGVPTYTWGENETDVFLLNSTRPPQGSWFGCTWMNSTGFTKTCGAPPCRTRADFNASTDLLCPTDCFRKHPDATYIKCGSGPWLTPKCLVHYPYRLWHYPCTVNFTIFKIRMYVGGVEHRLTAACNFTRGDRCDLEDRDRSQLSPLLHSTTEWAILPCTYSDLPALSTGLLHLHQNIVDVQYMYGLSPAITKYVVRWEWVVLLFLLLADARVCACLWMLILLGQAEA 384 750 D23F6BB597C72007 ns2-spcs1-4 4 NS2 7 unspecified role unspecified role bait bait cub cub cub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SPCS1 9 unspecified role unspecified role prey prey nub nub nub undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Results ns2-spcs1-1 3 SPCS1 9 unspecified role unspecified role bait bait c-terminal myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain NS2 7 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1B and 1E ns2-spcs1-2 1 SPCS1 9 unspecified role unspecified role bait bait c-terminal myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range NS2 7 unspecified role unspecified role prey prey physical association physical association Fig. 1C q99ib8_pro-spcs1-2 5 SPCS1 9 unspecified role unspecified role neutral component neutral component c-terminal myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain NS2 7 unspecified role unspecified role neutral component neutral component n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range proximity proximity close-contact colocalization neighbourhood interaction Fig. 1G q99ib8_pro-spcs1-1 5 SPCS1 9 unspecified role unspecified role neutral component neutral component E2 10 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Fig. S3 ns2-spcs1-3 2 NS2 7 unspecified role unspecified role neutral component neutral component mkg-c tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SPCS1 9 unspecified role unspecified role neutral component neutral component mkg-n tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1H e2-spcs1-1 2 E2 10 unspecified role unspecified role neutral component neutral component mkg-c tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SPCS1 9 unspecified role unspecified role neutral component neutral component mkg-n tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. S3 spcs1-ns2-1 3 NS2 7 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain SPCS1 9 unspecified role unspecified role bait bait c-terminal myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 1B and 1F spcs1-e2-1 6 P7 8 unspecified role unspecified role ancillary ancillary SPCS1 9 unspecified role unspecified role bait bait c-terminal myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain E2 10 unspecified role unspecified role prey prey physical association physical association Fig. 6B, 6C and S2 spcs1-e2-ns2-1 6 SPCS1 9 unspecified role unspecified role bait bait c-terminal myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range NS2 7 unspecified role unspecified role prey prey n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range E2 10 unspecified role unspecified role prey prey association association Fig. 6A ns2-e2-2 6 NS2 7 unspecified role unspecified role bait bait n-terminal flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range E2 10 unspecified role unspecified role prey prey physical association physical association Fig. 6A