IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Functional interaction of glutathione S-transferase pi and peroxiredoxin 6 in intact cells. Functional interaction of glutathione S-transferase pi and peroxiredoxin 6 in intact cells. Int. J. Biochem. Cell Biol. (1357-2725) 2013 imex curation Zhou S., Lien Y.C., Shuvaeva T., DeBolt K., Feinstein S.I., Fisher A.B. Affinomics - Interactions curated for the Affinomics consortium. abf@mail.med.upenn.edu 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zhou S., Lien Y.C., Shuvaeva T., DeBolt K., Feinstein S.I., Fisher A.B. Affinomics - Interactions curated for the Affinomics consortium. Pulmonary microvascular endothelial cells. abf@mail.med.upenn.edu Accepted 2014-JUN-24 by ORCHARD Int. J. Biochem. Cell Biol. (1357-2725) 2013 Only protein-protein interactions imex curation Functional interaction of glutathione S-transferase pi and peroxiredoxin 6 in intact cells. Functional interaction of glutathione S-transferase pi and peroxiredoxin 6 in intact cells. Int. J. Biochem. Cell Biol. (1357-2725) 2013 imex curation Zhou S., Lien Y.C., Shuvaeva T., DeBolt K., Feinstein S.I., Fisher A.B. Affinomics - Interactions curated for the Affinomics consortium. abf@mail.med.upenn.edu 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions human-a_549 Homo sapiens Caucasian lung carcinoma cell line a_549 Human Caucasian lung carcinoma pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zhou S., Lien Y.C., Shuvaeva T., DeBolt K., Feinstein S.I., Fisher A.B. Affinomics - Interactions curated for the Affinomics consortium. Pulmonary microvascular endothelial cells. abf@mail.med.upenn.edu Accepted 2014-JUN-24 by ORCHARD Int. J. Biochem. Cell Biol. (1357-2725) 2013 Only protein-protein interactions imex curation Functional interaction of glutathione S-transferase pi and peroxiredoxin 6 in intact cells. Functional interaction of glutathione S-transferase pi and peroxiredoxin 6 in intact cells. Int. J. Biochem. Cell Biol. (1357-2725) 2013 imex curation Zhou S., Lien Y.C., Shuvaeva T., DeBolt K., Feinstein S.I., Fisher A.B. Affinomics - Interactions curated for the Affinomics consortium. abf@mail.med.upenn.edu 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-endothelium Mus musculus endothelium Endothelial cells [endothelium] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zhou S., Lien Y.C., Shuvaeva T., DeBolt K., Feinstein S.I., Fisher A.B. Affinomics - Interactions curated for the Affinomics consortium. Pulmonary microvascular endothelial cells. abf@mail.med.upenn.edu Accepted 2014-JUN-24 by ORCHARD Int. J. Biochem. Cell Biol. (1357-2725) 2013 Only protein-protein interactions imex curation prdx6_mouse Peroxiredoxin-6 Lysophosphatidylcholine acyltransferase 5 Glutathione-dependent peroxiredoxin Antioxidant protein 2 1-Cys peroxiredoxin Acidic calcium-independent phospholipase A2 Non-selenium glutathione peroxidase Prdx6 Aop2 Ltw4 Prdx5 protein protein mouse Mus musculus Mouse MPGGLLLGDEAPNFEANTTIGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNGETPTEKLPFPIIDDKGRDLAILLGMLDPVEKDDNNMPVTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTGTKPVATPVDWKKGESVMVVPTLSEEEAKQCFPKGVFTKELPSGKKYLRYTPQP AECDEDD332858B8F gstp1_human Glutathione S-transferase P GSTP1 GST3 FAEES3 GST class-pi GSTP1-1 protein protein human Homo sapiens Human MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ 409E33FFAA338396 gstp1_mouse Glutathione S-transferase P 1 Gstp1 Gstpib GST YF-YF GST-piB GST class-pi Preadipocyte growth factor protein protein mouse Mus musculus Mouse MPPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTIDTWMQGLLKPTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKNQREAAQMDMVNDGVEDLRGKYVTLIYTNYENGKNDYVKALPGHLKPFETLLSQNQGGKAFIVGDQISFADYNLLDLLLIHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPEHVNRPINGNGKQ DAC7762F4E34FF27 prdx6_human Peroxiredoxin-6 PRDX6 AOP2 KIAA0106 Antioxidant protein 2 1-Cys peroxiredoxin Acidic calcium-independent phospholipase A2 Non-selenium glutathione peroxidase 24 kDa protein Liver 2D page spot 40 Red blood cells page spot 12 Glutathione-dependent peroxiredoxin Lysophosphatidylcholine acyltransferase 5 protein protein human Homo sapiens Human MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP 017D955F0FEEDFBC gstp1-prdx6 3 6 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection O08709:p.Cys47Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain C S Wed May 02 20:10:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys47ser' Tue Jun 30 18:02:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys47Ser' region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction 4 t-BOOH (tert-butylhydroperoxide) - an organic peroxide and oxidising agent. The association of endogenous Prdx6 and πGST occurred only in the presence of oxidative stress. gstp1-prdx6-1 3 4 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3, 5B t-BOOH (tert-butylhydroperoxide) - an organic peroxide and oxidising agent. The association of endogenous Prdx6 and πGST occurred only in the presence of oxidative stress. gstp1-prdx6-2 2 7 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Supp 3A hydrogen peroxide - an inorganic oxidising agent gstp1-prdx6-3 1 7 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection gfp_or_rfp_tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction Supp 3B t-BOOH - (tert-butylhydroperoxide) an organic oxidising agent