IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ PSA forms complexes with alpha-1-antichymotrypsin in prostate. PSA forms complexes with alpha-1-antichymotrypsin in prostate. Prostate (0270-4137) 2013 imex curation Zhu L., Jäämaa S., Af Hällström T.M., Laiho M., Sankila A., Nordling S., Stenman U.H., Koistinen H. Cancer - Interactions investigated in the context of cancer Affinomics - Interactions curated for the Affinomics consortium. hannu.k.koistinen@helsinki.fi 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-prostate_carcinoma Homo sapiens prostate carcinoma prostate_carcinoma Prostate carcinoma (cancer) pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Zhu L., Jäämaa S., Af Hällström T.M., Laiho M., Sankila A., Nordling S., Stenman U.H., Koistinen H. Cancer - Interactions investigated in the context of cancer hannu.k.koistinen@helsinki.fi Accepted 2013-AUG-23 by MGT 09-Sep-2013: Contacted by IntAct-Help. Prostate (0270-4137) 2013 Only protein-protein interactions imex curation klk3_human Prostate-specific antigen KLK3 APS Kallikrein-3 Semenogelase Gamma-seminoprotein P-30 antigen protein protein human Homo sapiens Human MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP AE9E732AF872141A aact_human Alpha-1-antichymotrypsin Cell growth-inhibiting gene 24/25 protein SERPINA3 AACT GIG24 GIG25 Serpin A3 protein protein human Homo sapiens Human MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLINDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQA B002F946C86A8951 klk3-serpina3 1 3 unspecified role unspecified role neutral component neutral component 2 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 4 This interaction is negative or dubious at best in normal prostate tissue.