IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. Cancer Cell (1535-6108) 2012 imex curation Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. Cancer - Interactions investigated in the context of cancer gabriele.bergers@ucsf.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions human-gbm43 Human GBM43 Xenografted Glioblastoma cell line gbm43 GBM43 Glioblastoma cell line -serially passaged subcutaneously in mice pla proximity ligation assay pELISA pELISA PLA tag visualisation tag visualisation Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. Human GBM43 cells, -primary cell cultures of patient-derived GBM specimens serially passaged as subcutaneous tumors in mice. gabriele.bergers@ucsf.edu Accepted 2012-JUL-19 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. Cancer Cell (1535-6108) 2012 imex curation Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. Cancer - Interactions investigated in the context of cancer gabriele.bergers@ucsf.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions human-hmec-1 Human HMEC-1 immortalized microvascular endothelial cell line hmec-1 HMEC-1 - microvascular endothelial cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. gabriele.bergers@ucsf.edu Accepted 2012-JUL-19 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. Cancer Cell (1535-6108) 2012 imex curation Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. Cancer - Interactions investigated in the context of cancer gabriele.bergers@ucsf.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions mouse-vegfko Mouse VEGFKO- astrocytoma- VEGF(A) knockout cell line vegfko Mouse VEGFKO- astrocytoma- VEGF(A) knockout cell line pla proximity ligation assay pELISA pELISA PLA tag visualisation tag visualisation Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. The cell line is MOUSE-vegfko - a slow growing astrocytoma with VEGF(A) knocked out. gabriele.bergers@ucsf.edu Accepted 2012-JUL-19 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. Cancer Cell (1535-6108) 2012 imex curation Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. Cancer - Interactions investigated in the context of cancer gabriele.bergers@ucsf.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions human-glioblastoma Homo sapiens glioblastoma glioblastoma Glioblastoma Glioblastoma is the same as 'Glioblastoma multiforme' (GBM) -is the same as Astrocytoma Grade 4. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. Dear checker:- in case you were wondering - 'Glioblastoma' is the same as Glioblastoma multiforme (GBM). gabriele.bergers@ucsf.edu Accepted 2012-JUL-19 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. Cancer Cell (1535-6108) 2012 imex curation Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. Cancer - Interactions investigated in the context of cancer gabriele.bergers@ucsf.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions human-gbm43 Human GBM43 Xenografted Glioblastoma cell line gbm43 GBM43 Glioblastoma cell line -serially passaged subcutaneously in mice anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. Dear checker:- in case you were wondering - 'Glioblastoma' is the same as Glioblastoma multiforme (GBM). Human GBM43 cells, -primary cell cultures of patient-derived GBM specimens serially passaged as subcutaneous tumors in mice. gabriele.bergers@ucsf.edu Accepted 2012-JUL-19 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. Cancer Cell (1535-6108) 2012 imex curation Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. Cancer - Interactions investigated in the context of cancer gabriele.bergers@ucsf.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions human-gbm43 Human GBM43 Xenografted Glioblastoma cell line gbm43 GBM43 Glioblastoma cell line -serially passaged subcutaneously in mice anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. Human GBM43 cells, -primary cell cultures of patient-derived GBM specimens serially passaged as subcutaneous tumors in mice. gabriele.bergers@ucsf.edu Accepted 2012-JUL-19 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. Cancer Cell (1535-6108) 2012 imex curation Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. Cancer - Interactions investigated in the context of cancer gabriele.bergers@ucsf.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions mouse-vegfko Mouse VEGFKO- astrocytoma- VEGF(A) knockout cell line vegfko Mouse VEGFKO- astrocytoma- VEGF(A) knockout cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. gabriele.bergers@ucsf.edu Accepted 2012-JUL-19 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. Cancer Cell (1535-6108) 2012 imex curation Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. Cancer - Interactions investigated in the context of cancer gabriele.bergers@ucsf.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions mouse-vegfko Mouse VEGFKO- astrocytoma- VEGF(A) knockout cell line vegfko Mouse VEGFKO- astrocytoma- VEGF(A) knockout cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. The cell line is MOUSE-vegfko - a slow growing astrocytoma with VEGF(A) knocked out. gabriele.bergers@ucsf.edu Accepted 2012-JUL-19 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. VEGF Inhibits Tumor Cell Invasion and Mesenchymal Transition through a MET/VEGFR2 Complex. Cancer Cell (1535-6108) 2012 imex curation Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. Cancer - Interactions investigated in the context of cancer gabriele.bergers@ucsf.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions human-gbm43 Human GBM43 Xenografted Glioblastoma cell line gbm43 GBM43 Glioblastoma cell line -serially passaged subcutaneously in mice crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Lu K.V., Chang J.P., Parachoniak C.A., Pandika M.M., Aghi M.K., Meyronet D., Isachenko N., Fouse S.D., Phillips J.J., Cheresh D.A., Park M., Bergers G. Affinomics - Interactions curated for the Affinomics consortium. Human GBM43 cells (grown in mice) were stimulated with HGF and/or VEGF, crosslinked with the membrane-permeable and cleavable crosslinker DSP and each lysate immunoprecipitated with an anti-MET antibody. gabriele.bergers@ucsf.edu Accepted 2012-JUL-19 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation met_human Hepatocyte growth factor receptor MET Scatter factor receptor HGF/SF receptor Tyrosine-protein kinase Met Proto-oncogene c-Met protein protein human Homo sapiens Human MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEFTTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPVFKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDLLKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPASFWETS DIP protein P08581 original sequence version: 94 DIP protein P08581 original sequence version: 200 DIP protein P08581 original sequence version: 128 DIP protein P08581-1 original sequence version: 166 DIP protein P08581 original sequence version: 211 9CF896D1273905C3 vgfr2_mouse Vascular endothelial growth factor receptor 2 Protein-tyrosine kinase receptor flk-1 Fetal liver kinase 1 Kinase NYK Kdr Flk-1 Flk1 protein protein mouse Mus musculus Mouse MESKALLAVALWFCVETRAASVGLPGDFLHPPKLSTQKDILTILANTTLQITCRGQRDLDWLWPNAQRDSEERVLVTECGGGDSIFCKTLTIPRVVGNDTGAYKCSYRDVDIASTVYVYVRDYRSPFIASVSDQHGIVYITENKNKTVVIPCRGSISNLNVSLCARYPEKRFVPDGNRISWDSEIGFTLPSYMISYAGMVFCEAKINDETYQSIMYIVVVVGYRIYDVILSPPHEIELSAGEKLVLNCTARTELNVGLDFTWHSPPSKSHHKKIVNRDVKPFPGTVAKMFLSTLTIESVTKSDQGEYTCVASSGRMIKRNRTFVRVHTKPFIAFGSGMKSLVEATVGSQVRIPVKYLSYPAPDIKWYRNGRPIESNYTMIVGDELTIMEVTERDAGNYTVILTNPISMEKQSHMVSLVVNVPPQIGEKALISPMDSYQYGTMQTLTCTVYANPPLHHIQWYWQLEEACSYRPGQTSPYACKEWRHVEDFQGGNKIEVTKNQYALIEGKNKTVSTLVIQAANVSALYKCEAINKAGRGERVISFHVIRGPEITVQPAAQPTEQESVSLLCTADRNTFENLTWYKLGSQATSVHMGESLTPVCKNLDALWKLNGTMFSNSTNDILIVAFQNASLQDQGDYVCSAQDKKTKKRHCLVKQLIILERMAPMITGNLENQTTTIGETIEVTCPASGNPTPHITWFKDNETLVEDSGIVLRDGNRNLTIRRVRKEDGGLYTCQACNVLGCARAETLFIIEGAQEKTNLEVIILVGTAVIAMFFWLLLVIVLRTVKRANEGELKTGYLSIVMDPDELPLDERCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCKTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRGKRNEFVPYKSKGARFRQGKDYVGELSVDLKRRLDSITSSQSSASSGFVEEKSLSDVEEEEASEELYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHEDPNQRPSFSELVEHLGNLLQANAQQDGKDYIVLPMSETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISHYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDSQTDSGMVLASEELKTLEDRNKLSPSFGGMMPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSDEAGLLKMVDAAVHADSGTTLRSPPV DIP protein P35918 original sequence version: 134 DIP protein P35918 original sequence version: 149 11859F8A58A33A39 ptn1_human Tyrosine-protein phosphatase non-receptor type 1 PTPN1 PTP1B Protein-tyrosine phosphatase 1B protein protein human Homo sapiens Human MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT DIP protein P18031 original sequence version: 141 DIP protein P18031 original sequence version: 191 802377DCD33F41FD vgfr2_human Vascular endothelial growth factor receptor 2 Kinase insert domain receptor Protein-tyrosine kinase receptor flk-1 KDR FLK1 Fetal liver kinase 1 VEGFR2 protein protein human Homo sapiens Human MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWLLLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV DIP protein P35968 original sequence version: 81 DIP protein P35968 original sequence version: 146 DIP protein P35968 original sequence version: 117 DIP protein P35968 original sequence version: 121 59E7C44B05CFEBB3 met_mouse Hepatocyte growth factor receptor Met Scatter factor receptor HGF/SF receptor Tyrosine-protein kinase Met Proto-oncogene c-Met protein protein mouse Mus musculus Mouse MKAPTVLAPGILVLLLSLVQRSHGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHGHHIYLGATNYIYVLNDKDLQKVSEFKTGPVLEHPDCLPCRDCSSKANSSGGVWKDNINMALLVDTYYDDQLISCGSVNRGTCQRHVLPPDNSADIQSEVHCMFSPEEESGQCPDCVVSALGAKVLLSEKDRFINFFVGNTINSSYPPGYSLHSISVRRLKETQDGFKFLTDQSYIDVLPEFLDSYPIKYIHAFESNHFIYFLTVQKETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECILTEKRRKRSTREEVFNILQAAYVSKPGANLAKQIGASPSDDILFGVFAQSKPDSAEPVNRSAVCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARSDEYRTEFTTALQRVDLFMGRLNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVLSRTAHLTPHVNFLLDSHPVSPEVIVEHPSNQNGYTLVVTGKKITKIPLNGLGCGHFQSCSQCLSAPYFIQCGWCHNQCVRFDECPSGTWTQEICLPAVYKVFPTSAPLEGGTVLTICGWDFGFRKNNKFDLRKTKVLLGNESCTLTLSESTTNTLKCTVGPAMSEHFNVSVIISNSRETTQYSAFSYVDPVITSISPRYGPQAGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTTSDEFPVKLKIDLANRETSSFSYREDPVVYEIHPTKSFISGGSTITGIGKTLNSVSLPKLVIDVHEVGVNYTVACQHRSNSEIICCTTPSLKQLGLQLPLKTKAFFLLDGILSKHFDLTYVHNPVFEPFEKPVMISMGNENVVEIKGNNIDPEAVKGEVLKVGNQSCESLHWHSGAVLCTVPSDLLKLNSELNIEWKQAVSSTVLGKVIVQPDQNFAGLIIGAVSISVVVLLLSGLFLWMRKRKHKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGACRQVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIEEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKCWHPKAEMRPSFSELVSRISSIFSTFIGEHYVHVNATYVNVKCVAPYPSLLPSQDNIDGEGNT FC5CC87FDD8ADED8 kdr-met 4 10 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association Fig 4A kdr-met-1 2 13 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig 4A kdr-met-2 5 13 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig 4A kdr-met-3 7 14 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c_terminal_region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain c-term range C-terminal range c-term range physical association physical association Fig 4B kdr-met-4 6 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c_terminal_region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain c-term range C-terminal range c-term range physical association physical association Fig 4C kdr-met-7 3 11 unspecified role unspecified role neutral component neutral component c_terminal_region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain c-term range C-terminal range c-term range 14 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Fig 4D kdr-met-8 1 10 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component c_terminal_region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction Fig 4E met-kdr-2 9 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig 5B HGF and VEGF met-kdr-3 8 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c_terminal_region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain c-term range C-terminal range c-term range 14 unspecified role unspecified role bait bait physical association physical association Fig 4B Presence of VEGFR2 confirmed by anti-tag western blot. met-kdr-4 5 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c_terminal_region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain c-term range C-terminal range c-term range [EBI-6248834]It was impossible to shift the feature ranges when the protein sequence has been updated. [EBI-6248834]918-0 [EBI-6248834]P35918,1 physical association physical association Fig 4C identification of VEGFR2 confirmed by western blot