IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. PLoS Genet. (1553-7390) 2011 imex curation Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Diabetes - Interactions investigated in the context of Diabetes I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Only protein-protein interactions mouse-testis Mus musculus testis testis anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Accepted 2012-JUN-21 by PPORRAS PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. PLoS Genet. (1553-7390) 2011 imex curation Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Diabetes - Interactions investigated in the context of Diabetes I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Only protein-protein interactions mouse-testis Mus musculus testis testis tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Accepted 2012-JUN-21 by PPORRAS PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. PLoS Genet. (1553-7390) 2011 imex curation Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Diabetes - Interactions investigated in the context of Diabetes I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Only protein-protein interactions human-rpe Human retinal pigment epithelium cell line rpe retinal pigmented epithelial cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Accepted 2012-JUN-21 by PPORRAS PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. PLoS Genet. (1553-7390) 2011 imex curation Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Diabetes - Interactions investigated in the context of Diabetes I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Only protein-protein interactions mouse-eye Mouse EYE eye EYE molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Accepted 2012-JUN-21 by PPORRAS PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. PLoS Genet. (1553-7390) 2011 imex curation Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Diabetes - Interactions investigated in the context of Diabetes I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Accepted 2012-JUN-21 by PPORRAS PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. PLoS Genet. (1553-7390) 2011 imex curation Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Diabetes - Interactions investigated in the context of Diabetes I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Only protein-protein interactions human-rpe Human retinal pigment epithelium cell line rpe retinal pigmented epithelial cells anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Accepted 2012-JUN-21 by PPORRAS PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. PLoS Genet. (1553-7390) 2011 imex curation Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Diabetes - Interactions investigated in the context of Diabetes I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Only protein-protein interactions mouse-testis Mus musculus testis testis molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Accepted 2012-JUN-21 by PPORRAS PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. PLoS Genet. (1553-7390) 2011 imex curation Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Diabetes - Interactions investigated in the context of Diabetes I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Only protein-protein interactions human-rpe Human retinal pigment epithelium cell line rpe retinal pigmented epithelial cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Accepted 2012-JUN-21 by PPORRAS PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. PLoS Genet. (1553-7390) 2011 imex curation Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Diabetes - Interactions investigated in the context of Diabetes I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Accepted 2012-JUN-21 by PPORRAS PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened. PLoS Genet. (1553-7390) 2011 imex curation Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. Diabetes - Interactions investigated in the context of Diabetes I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. tap tandem affinity purification TAP TAP tap ms participant Identification by mass spectrometry ms participant Seo S., Zhang Q., Bugge K., Breslow D.K., Searby C.C., Nachury M.V., Sheffield V.C. Affinomics - Interactions curated for the Affinomics consortium. I have written recently to this this author (Val Sheffield) regarding at least one other paper -HE does NOT reply to emails - not to mine at any rate... so no point in contacting... Co-IP using an anti-GFP antibody to one component of the LAP/TAP tag - LAP-BBS4. It has been assumed that 'LZTFL1' is Human in origin throughout this publication, and 'Lztfl1' is Murine, though this is not explicitly stated in the paper. However in F igs S2D/E this paper does refer to:- "smaller isoforms of LZTFL1 (AK093705 and AK303416) " - which are both Human in origin. val-sheffield@uiowa.edu Accepted 2012-JUN-21 by PPORRAS PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation lztl1_human Leucine zipper transcription factor-like protein 1 LZTFL1 protein protein human Homo sapiens Human MAELGLNEHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEDTFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAPLNEGGTAELLNKEILRLQEENEKLKSRLKTIEIQATNALDEKSKLEKALQDLQLDQGNQKDFIKAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED DCCD59AB98ED2C8A ttc8_mouse Tetratricopeptide repeat protein 8 Ttc8 Bbs8 Bardet-Biedl syndrome 8 protein homolog protein protein mouse Mus musculus Mouse MGSEMEPLLRAWSYFRRRKFQLCADLCTQMLEKSPYDQEPAPDLPVSQAAWILKARALTEMVYIDEIDVDQEGIAEMILDENAIAQVPRPGTSLKLPGTNQTGGPTQAVRPITQAGRPITGFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRLNLTKYSQKPKLAKALFEYILHHENDVKMALDLASLSTEYSQYKDWWWKVQIGKCYYRLGMYREAEKQFKSALKQQEMVDTFLYLAKVYIILDQPVTALNLFKQGLDKFPGEVTLLCGIARIYEEMNNSSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEVALRFYRRLLQMGVYNCQLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHIAVGIGDTNLAHQCFRLALVHNNHHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATVSDKIGDLQRSYVAAQKSEVAFPEHVDTQHLIKQLKQHFAML DIP protein Q8VD72 original sequence version: 76 9A8ACDF59BB641C1 bbs7_mouse Bardet-Biedl syndrome 7 protein homolog Bbs7 Bbs2l1 BBS2-like protein 1 protein protein mouse Mus musculus Mouse MDLTLSRADYLQVGVTSQKTMKLLPTSRQRATQKVVVGDQDGVVICFGVKKGEAVPVFKTLPGQKISRLELGGAVNTPQEKIFIAAGSEIRGFTKRGKQFLSFETNLTESIKAMYISGSDLFLSASYIYNHYCDCKDQNYYLSGDKINDVICLPVEKLSRVTPVLACQDRVLRVLQGSDVMYEIEVPGPPTVLALHNGDGGDSGEGLLFGTSDGRLGLIQITTSKPIHKWEIRNDKKRGGILCVDSFDIMGDGVKDLLVGRDDGMVEVYSFENANEPVLRFDQMLSESVTSIQGGCVGKDGYDEIVLATYSGWVTGLTTEPTHKESGPGEELKLNQEMQNKISSLRSEIEHLQFKVLQERENYQQSSQSSQAKSTVPSFSINDKFTLNKEDASYSLVLEVRTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDTESNDNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECATFYFQNTFLDTQLECVYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQVHEGNTDFLTPEYRCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPMLLEILDSYDQNTLISFFDAA DIP protein Q8K2G4 original sequence version: 52 F7D8C284B04DA15B lztl1_mouse Leucine zipper transcription factor-like protein 1 Lztfl1 protein protein mouse Mus musculus Mouse MAELGLNEHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKDSRLVEETFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFSQAEKWYLKLQTDISELENRELLEQVAEFEKAEFVSSSKKPIIDITKPKLVPINEGGTTELLNKEILRLQQENEKLKSRLKTIEIQAVNALDEKSKLERVLQDLQLDQENQQDLLKAQDLDDLENTVATLRSEFQKTLNDKTENQKSLEENLAAAKHDLLRVQEQLSMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAKYESED 49F19871A72D48E7 smo_mouse Smoothened homolog Smo Smoh protein protein mouse Mus musculus Mouse MAAGRPVRGPELAPRRLLQLLLLVLLGGPGRGAALSGNVTGPGPHSASGSSRRDVPVTSPPPPLLSHCGRAAHCEPLRYNVCLGSALPYGATTTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDHFPEGCPNEVQNIKFNSSGQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRFGEPTSSETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKKPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGHSDDEPKRIKKSKMIAKAFSKRRELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDVSVTPVATPVPPEEQANMWLVEAEISPELEKRLGRKKKRRKRKKEVCPLRPAPELHHSAPVPATSAVPRLPQLPRQKCLVAANAWGTGESCRQGAWTLVSNPFCPEPSPHQDPFLPGASAPRVWAQGRLQGLGSIHSRTNLMEAEILDADSDF DEAD556A45F7C960 pthb1_human Protein PTHB1 PTHB1 Parathyroid hormone-responsive B1 gene protein Bardet-Biedl syndrome 9 protein BBS9 protein protein human Homo sapiens Human MSLFKARDWWSTILGDKEEFDQGCLCLANVDNSGNGQDKIIVGSFMGYLRIFSPHPAKTGDGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQCQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLLPGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLNIGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGTINTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLHDLKGVIVTLSDDGHLQCSYLGTDPSLFQAPNVQSRELNYDELDVEMKELQKIIKDVNKSQGVWPMTEREDDLNVSVVVSPNFDSVSQATDVEVGTDLVPSVTVKVTLQNRVILQKAKLSVYVQPPLELTCDQFTFEFMTPDLTRTVSFSVYLKRSYTPSELEGNAVVSYSRPTDRNPDGIPRVIQCKFRLPLKLICLPGQPSKTASHKITIDTNKSPVSLLSLFPGFASQSDDDQVNVMGFHFLGGARITVLASKTSQRYRIQSEQFEDLWLITNELILRLQEYFEKQGVKDFACSFSGSIPLQEYFELIDHHFELRINGEKLEELLSERAVQFRAIQRRLLARFKDKTPAPLQHLDTLLDGTYKQVIALADAVEENQGNLFQSFTRLKSATHLVILLIALWQKLSADQVAILEAAFLPLQEDTQELGWEETVDAAISHLLKTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRLSKGGRLCLSTDAAAPQTMVMPGGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQGVSE DIP protein Q3SYG4 original sequence version: 47 8E333B7680243B7A pthb1_mouse Protein PTHB1 Bbs9 Pthb1 Bardet-Biedl syndrome 9 protein homolog Parathyroid hormone-responsive B1 gene protein homolog protein protein mouse Mus musculus Mouse MSLFKARDWWSTVLGEKEEFDQGCLCLADVDNSGNGHDKIIVGSFMGYLRIFSPHSVKAGGGPQAEDLLLEVHLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQYQIKLMYEHHLQRTACNMTYGPFGGVKGRDLICIQSLDGMLMVFEQESYAFGRFLPGFLLPGPLAYSPRTDSFITVSSCRQVESYKYQVLAFATDADKKQEMEQQKLGSGKRLVVDWTLNIGEQALDICIFPLNQSASSVFVLGERNFFCLKDNGQIRFMKKLGYNPSCFLPYCSVSEGTINTLIGNHNHMLHIYQDVTLKWATQLPHVPVAVRVGCFHDLKGVIVTLSDDGHLQCSYLGTDPSLFQAPKVESRELNYDELDVELKELQKIIKDVKLQGVWPLTEQEDDLKVSASVSSTLDSVSQATNVEPGADSVPSITVKITLQNRVVLQKVKLSIYVQPPLQLTCDQFTFDFTVPDMTSSVAFSVYLKRNYTPSELEGNAVVSYSRPTDRNPDGIPRVVQCKFRLPLKLICLPGQPSKTASHKLTIDTNKSPVSLLGLFPDFANPSDDDQVNVMGFRLLGGARVTLLASRTSQRYRIQSEQFEDLWLITNELILRLQEHFEKQGTKDFSCSFSGCVPLQEYFELIDHHFELRINGKKLEELLSERAVQFRAIQRRLLTRFRDKTPAPLQHLDTLLDGTYKQVIALADAIEENQDRLLQSFSGLKSATHLLILLIRLWQRLSADQTAILEAAFLPLQEDTQELGWEETVDAAIAYLLKTCLSKSSKEQALNLSSQLNIPKDTSRLKKHITLLCDRLAKGGRLCVSTDAAAPQAMVVPGGCTPIPESDLEERSLDDSTELFTNHKHLMTEPPMPEVSARQGVLE 46C4580518630E36 bbs5_mouse Bardet-Biedl syndrome 5 protein homolog Bbs5 protein protein mouse Mus musculus Mouse MSVLDVLWEDRDVRFDVSSQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWHSLALPRVNLSIGYNCILNITTRTANSKLRGQTEALYILTKCNTTRFEFIFTNLVPGSPRLFTSVIAVHRAYETSKMYRDFKLRSAVIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVNYEMEEKPQPLEALTVEQIQDDVEIDSDDHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS 8FD2BF5943F72325 bbs1_mouse Bardet-Biedl syndrome 1 protein homolog Bbs1 protein protein mouse Mus musculus Mouse MAAASSSDSDSGRAESNEANSKWLDAHYDPMANIHTFSSCLSLADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPTVLTESPLPALPASAATFLMDQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDIREKADVPLSVQSLRFLQLELSEMEAFVNQHKSKVIKRQTVITTMTTLKKNLADEDAASCLVLGTESKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLTAACRNGSIYILRRDSKHPKYCIELSAQPVGLVRVHKVLVVGSTQESLHGFTHKGKKLWTVQMPAAILTMNLLEQRSRGLQAVMAALANGEVRIYRDKALLNVIHAPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGTGEVGPPLAQTTKLSVPRKTRLYVDQTLREREAGTAMHRTFQTDLYLLRLRAARAYVQALESSLSPMSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTARPVLGLHVCFLYNKALYALPQAFFKVPLLVPGLSYPLETFVESLSSKGISDMIKVLVLREGQSAPLLSAHINMPVSEGLAAA 322E9DD4DD554813 322E9DD4DD554813 bbs1_human Bardet-Biedl syndrome 1 protein BBS1 BBS2L2 BBS2-like protein 2 protein protein human Homo sapiens Human MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLGPGGQQPRLKVLKGPLVMTESPLPALPAAAATFLMEQHEPRTPALALASGPCVYVYKNLRPYFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLESIRETAEEPLSIQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRDKALLNVIHTPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGGSEVGPPPAQAMKLNVPRKTRLYVDQTLREREAGTAMHRAFQTDLYLLRLRAARAYLQALESSLSPLSTTAREPLKLHAVVQGLGPTFKLTLHLQNTSTTRPVLGLLVCFLYNEALYSLPRAFFKVPLLVPGLNYPLETFVESLSNKGISDIIKVLVLREGQSAPLLSAHVNMPGSEGLAAA DIP protein Q8NFJ9 original sequence version: 88 DIP protein Q8NFJ9 original sequence version: 62 DIP protein Q8NFJ9 original sequence version: 67 DIP protein Q8NFJ9-1 original sequence version: 100 94C0C05667FE582D bbs2_human Bardet-Biedl syndrome 2 protein BBS2 protein protein human Homo sapiens Human MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDVSLLNINQAVSCLTAGVLNPELGYDALLVGTQTNLLAYDVYNNSDLFYREVADGANAIVLGTLGDISSPLAIIGGNCALQGFNHEGSDLFWTVTGDNVNSLALCDFDGDGKKELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTSRYWRIKSKNHAMSIHAFDLNSDGVNELITGWSNGKVDARSDRTGEVIFKDNFSSAIAGVVEGDYRMDGHIQLICCSVDGEIRGYLPGTAEMRGNLMDTSAEQDLIRELSQKKQNLLLELRNYEENAKAELASPLNEADGHRGIIPANTRLHTTLSVSLGNETQTAHTELRISTSNDTIIRAVLIFAEGIFTGESHVVHPSIHNLSSSICIPIVPPKDVPVDLHLKAFVGYRSSTQFHVFESTRQLPRFSMYALTSLDPASEPISYVNFTIAERAQRVVVWLGQNFLLPEDTHIQNAPFQVCFTSLRNGGHLHIKIKLSGEITINTDDIDLAGDIIQSMASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADHSNLIRSLLVGAEDARLMRDMKTMKSRYMELYDLNRDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVITACRDAIRSNNINTLFKIMRVGTASS DIP protein Q9BXC9 original sequence version: 105 DIP protein Q9BXC9 original sequence version: 79 8FA1CDAED725BEAF bbs5_human Bardet-Biedl syndrome 5 protein BBS5 protein protein human Homo sapiens Human MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRILWHSLALSRVNVSVGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLVPGSPRLFTSVMAVHRAYETSKMYRDFKLRSALIQNKQLRLLPQEHVYDKINGVWNLSSDQGNLGTFFITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPVEKLQESVKEINSLHKVYSASPIFGVDYEMEEKPQPLEALTVEQIQDDVEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS DIP protein Q8N3I7 original sequence version: 95 DIP protein Q8N3I7 original sequence version: 69 63D67D877FDFD25B bbs4_human Bardet-Biedl syndrome 4 protein BBS4 protein protein human Homo sapiens Human MAEERVATRTQFPVSTESQKPRQKKAPEFPILEKQNWLIHLHYIRKDYEACKAVIKEQLQETQGLCEYAIYVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAAIEVYNEAAKLNQKDWEISHNLGVCYIYLKQFNKAQDQLHNALNLNRHDLTYIMLGKIHLLEGDLDKAIEVYKKAVEFSPENTELLTTLGLLYLQLGIYQKAFEHLGNALTYDPTNYKAILAAGSMMQTHGDFDVALTKYRVVACAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLAPFDWKILYNLGLVHLTMQQYASAFHFLSAAINFQPKMGELYMLLAVALTNLEDIENAKRAYAEAVHLDKCNPLVNLNYAVLLYNQGEKKNALAQYQEMEKKVSLLKDNSSLEFDSEMVEMAQKLGAALQVGEALVWTKPVKDPKSKHQTTSTSKPASFQQPLGSNQALGQAMSSAAAYRTLPSGAGGTSQFTKPPSLPLEPEPAVESSPTETSEQIREK DIP protein Q96RK4 original sequence version: 122 DIP protein Q96RK4 original sequence version: 90 59BC9B29355C8E3C bbs2_mouse Bardet-Biedl syndrome 2 protein homolog Bbs2 protein protein mouse Mus musculus Mouse MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQAGKVFIHNPHTRSQHFSASRVFQSPLESDVSLLNINQTVSCLGSGVLNPELGYDTLLVGTQTSLLAYDIYNNSDLFYREVSDGANAIVLGTLGDIAPPLAIIGGNCALQGFDHEGNDLFWTVTGDNVHSLALCDFDGDGKTELLVGSEDFDIRVFKEDEIVAEMTETEIVTSLCPMYGSRFGYALSNGTVGVYDKTARYWRIKSKNHAMSIHAFDINSDGVCELITGWSNGKVDARSDRTGEVIFKDNFSSAVAGVVEGDYRMDGHVQLICCSVDGEIRGYLPGTAEMKGNLLDTSVEQDLIRELSQKKQNLLLELRNYEESTKAELSSPLNEADGQKGIIPANTRLHTALSVNMGNDLQDAHAELGISTSNDTIIRAVLIFAEGIFVGESHVVHPSIHNLSSSLRVPITPPKDVPVDLHLKTFVGYRSSTQFHVFELTRQLPRFTMYALTSPDAASEPVSYVNFSVAERTQRMVTWLNQNFLLPEDSNVQNSPFHVCFTSLRNGGQLYIKMKQSGEITVNTDDIDLAGDIIQSIASFFAIEDLQVEADFPVYFEELRKVLVKVDEYHSVHQKLSADMADNSNLIRSLLVRAEDARLMRDMKTMKSRYMELYDLNKDLLNGYKIRCNNHTELLGNLKAVNQAIQRAGRLRVGKPKNQVISACRDAIRSNNINTLFRIMRVGTAPS DIP protein Q9CWF6 original sequence version: 63 C91D9B7834B614F4 bbs7_human Bardet-Biedl syndrome 7 protein BBS7 BBS2L1 BBS2-like protein 1 protein protein human Homo sapiens Human MDLILNRMDYLQVGVTSQKTMKLIPASRHRATQKVVIGDHDGVVMCFGMKKGEAAAVFKTLPGPKIARLELGGVINTPQEKIFIAAASEIRGFTKRGKQFLSFETNLTESIKAMHISGSDLFLSASYIYNHYCDCKDQHYYLSGDKINDVICLPVERLSRITPVLACQDRVLRVLQGSDVMYAVEVPGPPTVLALHNGNGGDSGEDLLFGTSDGKLALIQITTSKPVRKWEIQNEKKRGGILCIDSFDIVGDGVKDLLVGRDDGMVEVYSFDNANEPVLRFDQMLSESVTSIQGGCVGKDSYDEIVVSTYSGWVTGLTTEPIHKESGPGEELKINQEMQNKISSLRNELEHLQYKVLQERENYQQSSQSSKAKSAVPSFGINDKFTLNKDDASYSLILEVQTAIDNVLIQSDVPIDLLDVDKNSAVVSFSSCDSESNDNFLLATYRCQADTTRLELKIRSIEGQYGTLQAYVTPRIQPKTCQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWVVFCLPEVPEKPPAGECVTFYFQNTFLDTQLESTYRKGEGVFKSDNISTISILKDVLSKEATKRKINLNISYEINEVSVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQIHEGNTNFLIPEYHCILEEADHLQEEYKKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPLLLEILDSYDQNALISFFDAA DIP protein Q8IWZ6 original sequence version: 95 DIP protein Q8IWZ6 original sequence version: 66 A7856647969713FF bbs4-bbs1-1 1 13 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait n_terminal_gfp_tev_s_tap_tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association Fig S1B bbs4-bbs1-1 2 18 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait n_terminal_gfp_tev_s_tap_tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey association association Fig 1A , Table S1. lztfl1-bbs2-1 10 11 unspecified role unspecified role bait bait flag_s_tap_tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 25 unspecified role unspecified role prey prey association association Fig 1B , Table S2. bbs9-lztfl1 5 16 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1C lztfl1-bbs9 5 16 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait c_terminal_region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1D bbs4-bbs1-1 7 13 unspecified role unspecified role neutral component neutral component 23 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component 24 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component physical association physical association Fig 1E The peak of LZTFL1 was separated from that of the BBSome. bbs4-bbs1-1 4 24 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component 23 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component physical association physical association Fig 1E The peak of LZTFL1 was well separated from that of the BBSome. with a little "imagination" it can be seen that the bands for LZTFL1 really do (slightly) overlap with the other mols....so can be entered as an interaction. bbs9-lztfl1-1 3 16 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Fig 2C bbs9-lztfl1-2 8 11 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 2E Over-expression of wild-type LZTFL1 inhibited ciliary localization of BBS9. Removal of the N-terminal 70 amino acids from LZTFL1 and the KR mutation increase ciliary localisation. bbs1-smo 6 20 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 4C bbs4-smo-1 6 23 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 4C bbs5-smo 6 15 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined wr_containing_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 22 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 4C/D bbs7-smo 6 25 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined wr_containing_motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 4C/D lztfl1-lztl1 5 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig S2D lztfl1-lztfl1 9 11 unspecified role unspecified role prey prey physical association physical association Fig S2E lztfl1-lztfl1-1 5 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig S2F