IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ HSP25 can modulate myofibrillar desmin cytoskeleton following the phosphorylation at Ser15 in rat soleus muscle. HSP25 can modulate myofibrillar desmin cytoskeleton following the phosphorylation at Ser15 in rat soleus muscle. J. Appl. Physiol. (8750-7587) 2012 imex curation Kawano F., Fujita R., Nakai N., Terada M., Ohira T., Ohira Y. Affinomics - Interactions curated for the Affinomics consortium. Interactions involving actinin were not included because the antibody used did not allow for identification of the specific protein involved. ohira@space.hss.osaka-u.ac.jp 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions rat-skeletal_muscle rat skeletal muscle skeletal_muscle Skeletal muscle fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Kawano F., Fujita R., Nakai N., Terada M., Ohira T., Ohira Y. Affinomics - Interactions curated for the Affinomics consortium. Interactions involving actinin were not included because the antibody used did not allow for identification of the specific protein involved. ohira@space.hss.osaka-u.ac.jp Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. J. Appl. Physiol. (8750-7587) 2012 Only protein-protein interactions imex curation HSP25 can modulate myofibrillar desmin cytoskeleton following the phosphorylation at Ser15 in rat soleus muscle. HSP25 can modulate myofibrillar desmin cytoskeleton following the phosphorylation at Ser15 in rat soleus muscle. J. Appl. Physiol. (8750-7587) 2012 imex curation Kawano F., Fujita R., Nakai N., Terada M., Ohira T., Ohira Y. Affinomics - Interactions curated for the Affinomics consortium. Interactions involving actinin were not included because the antibody used did not allow for identification of the specific protein involved. ohira@space.hss.osaka-u.ac.jp 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions rat-skeletal_muscle rat skeletal muscle skeletal_muscle Skeletal muscle pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Kawano F., Fujita R., Nakai N., Terada M., Ohira T., Ohira Y. Affinomics - Interactions curated for the Affinomics consortium. Interactions involving actinin were not included because the antibody used did not allow for identification of the specific protein involved. ohira@space.hss.osaka-u.ac.jp Accepted 2013-SEP-19 by MGT 30-Sept-2013: Contacted by IntAct-Help. J. Appl. Physiol. (8750-7587) 2012 Only protein-protein interactions imex curation desm_rat Desmin Des protein protein rat Rattus norvegicus (Rat) Rat MSQAYSSSQRVSSYRRTFGGAPGFSLGSPLSSPVFPRAGFGTKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRAPSYGAGELLDFSLADAVNQEFLATRTNEKVELQELNDRFANYFEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEEMRELRRQVEVLTNQRARVDVERDNLIDDLQRLKAKLQEEIQLREEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTFSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL 4E53A71FC1C55BDF hspb1_rat Heat shock protein beta-1 Heat shock 27 kDa protein Hspb1 Hsp27 protein protein rat Rattus norvegicus (Rat) Rat MTERRVPFSLLRSPSWEPFRDWYPAHSRLFDQAFGVPRFPDEWSQWFSSAGWPGYVRPLPAATAEGPAAVTLARPAFSRALNRQLSSGVSEIRQTADRWRVSLDVNHFAPEELTVKTKEGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLPKAVTQSAEITIPVTFEARAQIGGPESEQSGAK 1CEC75582E5E34B2 des-hspb1 2 4 unspecified role unspecified role neutral component neutral component possible_phospho_ser15 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 8 Interaction is enhanced in muscle under mechanical stress. des-hspb1-1 1 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component possible_phospho_ser15 opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain colocalization colocalization 7 Interaction is enhanced in muscle under mechanical stress.