IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Moderate caveolin-1 downregulation prevents NADPH oxidase-dependent endothelial nitric oxide synthase uncoupling by angiotensin II in endothelial cells. Moderate caveolin-1 downregulation prevents NADPH oxidase-dependent endothelial nitric oxide synthase uncoupling by angiotensin II in endothelial cells. Arterioscler. Thromb. Vasc. Biol. (1079-5642) 2011 imex curation Lobysheva I., Rath G., Sekkali B., Bouzin C., Feron O., Gallez B., Dessy C., Balligand J.L. Affinomics - Interactions curated for the Affinomics consortium. irina.lobysheva@uclouvain.be,jl.balligand@uclouvain.be 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions human-uvec Human Umbilical Vein Endothelial Cells (HUVEC) huvec umbilical_vein_endothelium Umbilical vein endothelial cell [Umbilical vein endothelium] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Lobysheva I., Rath G., Sekkali B., Bouzin C., Feron O., Gallez B., Dessy C., Balligand J.L. Affinomics - Interactions curated for the Affinomics consortium. irina.lobysheva@uclouvain.be,jl.balligand@uclouvain.be Accepted 2014-FEB-12 by ORCHARD Arterioscler. Thromb. Vasc. Biol. (1079-5642) 2011 imex curation Moderate caveolin-1 downregulation prevents NADPH oxidase-dependent endothelial nitric oxide synthase uncoupling by angiotensin II in endothelial cells. Moderate caveolin-1 downregulation prevents NADPH oxidase-dependent endothelial nitric oxide synthase uncoupling by angiotensin II in endothelial cells. Arterioscler. Thromb. Vasc. Biol. (1079-5642) 2011 imex curation Lobysheva I., Rath G., Sekkali B., Bouzin C., Feron O., Gallez B., Dessy C., Balligand J.L. Affinomics - Interactions curated for the Affinomics consortium. irina.lobysheva@uclouvain.be,jl.balligand@uclouvain.be 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-endothelium Mus musculus endothelium Endothelial cells [endothelium] pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Lobysheva I., Rath G., Sekkali B., Bouzin C., Feron O., Gallez B., Dessy C., Balligand J.L. Affinomics - Interactions curated for the Affinomics consortium. Aortic endothelial cells. irina.lobysheva@uclouvain.be,jl.balligand@uclouvain.be Accepted 2014-FEB-12 by ORCHARD Arterioscler. Thromb. Vasc. Biol. (1079-5642) 2011 imex curation cav1_mouse Caveolin-1 Cav1 Cav protein protein mouse Mus musculus Mouse MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVTEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI DIP protein P49817 original sequence version: 94 DIP protein P49817 original sequence version: 143 DIP protein P49817 original sequence version: 168 CF88FE9B1D3D67AE ncf1_mouse Neutrophil cytosol factor 1 Neutrophil NADPH oxidase factor 1 47 kDa neutrophil oxidase factor p47-phox NCF-47K Ncf1 protein protein mouse Mus musculus Mouse MGDTFIRHIALLGFEKRFIPSQHYVYMFLVKWQDLSEKVVYRKFTEIYEFHKMLKEMFPIEAGEIHTENRVIPHLPAPRWFDGQRAAESRQGTLTEYFNGLMGLPVKISRCPHLLDFFKVRPDDLKLPTDSQAKKPETYLVPKDGKNNVADITGPIILQTYRAIADYEKSSGTEMTVATGDVVDVVEKSESGWWFCQMKTKRGWVPASYLEPLDSPDEAEDPDPNYAGEPYVTIKAYAAVEEDEMSLSEGEAIEVIHKLLDGWWVVRKGDITGYFPSMYLQKAGEEITQAQRQIRGRGAPPRRSTIRNAQSIHQRSRKRLSQDTYRRNSVRFLQQRRRPGRPGPLSTDGTKDNPSTPRVKPQPAVPPRPSSDLILHRCTESTKRKLTSAV C8EFAB953839CE9A cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI DIP protein Q03135 original sequence version: 164 DIP protein Q03135 original sequence version: 119 DIP protein Q03135 original sequence version: 122 DIP protein Q03135-1 original sequence version: 122 DIP protein Q03135 original sequence version: 133 DIP protein Q03135 original sequence version: 155 DIP protein Q03135 original sequence version: 147 2424DE9B5E6521D5 ncf1_human Neutrophil cytosol factor 1 NCF1 Neutrophil NADPH oxidase factor 1 47 kDa neutrophil oxidase factor p47-phox NCF-47K 47 kDa autosomal chronic granulomatous disease protein Nox-organizing protein 2 Nox organizer 2 SH3 and PX domain-containing protein 1A NOXO2 SH3PXD1A protein protein human Homo sapiens Human MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLMPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAV 3D91EDC99A1B6417 cav1-ncf1 1 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3A, Supp fig 5. Angiotensin II; the signal doubled after 15 minutes of AII stimulation. Cav-1 siRNA cav1-ncf1-1 2 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5A Angiotensin II; the signal doubled after 15 minutes of AII stimulation. The PLA signal was suppressed in Cav-1+/− ECs (Figure 5A and 5B, left) and, contrary to control cells, was not increased under AII stimulation.