IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Ligand-induced tyrosine phosphorylation of cysteinyl leukotriene receptor 1 triggers internalization and signaling in intestinal epithelial cells. Ligand-induced tyrosine phosphorylation of cysteinyl leukotriene receptor 1 triggers internalization and signaling in intestinal epithelial cells. PLoS ONE 2010 imex curation Parhamifar L., Sime W., Yudina Y., Vilhardt F., Mörgelin M., Sjölander A. Affinomics - Interactions curated for the Affinomics consortium. anita.sjolander@med.lu.se 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Parhamifar L., Sime W., Yudina Y., Vilhardt F., Mörgelin M., Sjölander A. Affinomics - Interactions curated for the Affinomics consortium. The authors have stated that the cell line INT 407 (intestinal epithelium) was used- but this cell line has been reported (Nelson-Rees & Flandermeyer (1976); Lacroix (2008)) to have been overgrown by HeLa cells. anita.sjolander@med.lu.se Accepted 2014-APR-24 by ORCHARD PLoS ONE 2010 Only protein-protein interactions imex curation Ligand-induced tyrosine phosphorylation of cysteinyl leukotriene receptor 1 triggers internalization and signaling in intestinal epithelial cells. Ligand-induced tyrosine phosphorylation of cysteinyl leukotriene receptor 1 triggers internalization and signaling in intestinal epithelial cells. PLoS ONE 2010 imex curation Parhamifar L., Sime W., Yudina Y., Vilhardt F., Mörgelin M., Sjölander A. Affinomics - Interactions curated for the Affinomics consortium. anita.sjolander@med.lu.se 12-May-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Parhamifar L., Sime W., Yudina Y., Vilhardt F., Mörgelin M., Sjölander A. Affinomics - Interactions curated for the Affinomics consortium. anita.sjolander@med.lu.se Accepted 2014-APR-24 by ORCHARD PLoS ONE 2010 Only protein-protein interactions imex curation cltr2_human Cysteinyl leukotriene receptor 2 CYSLTR2 CYSLT2 CYSLT2R G-protein coupled receptor GPCR21 G-protein coupled receptor HG57 HPN321 PSEC0146 protein protein human Homo sapiens Human MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSIYVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYVNMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQNGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRVSHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACFNPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV cltr1_human Cysteinyl leukotriene receptor 1 CYSLTR1 CYSLT1 Cysteinyl leukotriene D4 receptor G-protein coupled receptor HG55 HMTMF81 protein protein human Homo sapiens Human MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV B9B53940F895F245 cysltr1-cysltr2 1 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 1A the paper states:"The heterodimers (red dots) were concentrated to the plasma membrane and the nuclear region " - however looking at image it would appear to have red dots around the nuclear area AND around the nucleus itself - so have entered extra GO term... Five minutes after LTD4 (Leukotriene D4) addition a deccrease in receptor heterodimerization was observed;however after 60 minutes of LTD4 stimulation, a slight increase in heterodimerization compared to the 5 minutes value was observed. Genistein reduced this increase. cysltr2-cysltr1 2 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Supp 1 LD4-Leukotriene D4