MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint saumonneau-2008-1 Interaction of grape ASR proteins with a DREB transcription factor in the nucleus. vitvi-protoplast vitvi Grape protoplast Protoplast defined as a membrane-bound cell from which the outer wall has been partially or completely removed. bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Saumonneau A., Agasse A., Bidoyen MT., Lallemand M., Cantereau A., Medici A., Laloi M., Atanassova R. FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation saumonne-2008-1 Interaction of grape ASR proteins with a DREB transcription factor in the nucleus. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Saumonneau A., Agasse A., Bidoyen MT., Lallemand M., Cantereau A., Medici A., Laloi M., Atanassova R. FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation q94g23_vitvi MSA protein protein vitvi vitvi Grape MSEEKHHHHLFHHKDKPVDDAVPYSDNAYSDTTYSDTSYATDGVSGYAAETTEVLADDPAPDYRKEEKHHKHLEHLGELGVAAAGAYALHEKHKSEKDPEHAHKHKIEEEIAAAAAVGAGGFAFHEHHEKKEAKEEDEEAHGKKHHHLF mint a6xa90_vitvi VIT_07s0031g00190 protein protein vitvi vitvi Grape MEGGQECCSSRETRKRVTGQGEKRYKGIRMRKWGKWVAEIREPNKRSRIWLGSYSTPVAAARAYDTAVFHLRGPSARLNFPEYLVGEGGLHDTSAASIRKKATEVGATVDAIECARTASNQYKSCAFSEKPDLNKEPDPENSDVDDDHHYHL mint a6xa90-msa 763464 q94g23_vitvi VvMSA 763466 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false a6xa90_vitvi VvDREB 763467 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F5 mint msa-a6xa90 763465 q94g23_vitvi VvMSA 763466 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false a6xa90_vitvi VvDREB 763467 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3 mint