IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ risseeuw-2003-2 Protein interaction analysis of SCF ubiquitin E3 ligase subunits from Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Risseeuw EP., Daskalchuk TE., Banks TW., Liu E., Cotelesage J., Hellmann H., Estelle M., Somers DE., Crosby WL. There appears to be a discrepency between the results described within the text (page 762) and figure 5 of this report, concerning interaction between F box proteins and Cullin proteins. The data relating to these protein protein interactions was therefore not included in this entry. Source of the arabidopsis cDNA library used in this study was not given in this report. A directed yeast two hybrid assay was used in this study. bcrosby@uwindsor.ca Plant J. (0960-7412) 2003 skp1a_arath SKP1-like protein 1A UFO-binding protein 1 SKP1 UIP1 At1g75950 T4O12.17 SKP1A ASK1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE ski14_arath F-box protein SKIP14 At3g26000 SKIP14 SKP1-interacting partner 14 MPE11.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MALNFSHRPFSSHLSEEPMMIANGNWCSSFDNGRKNTGGDASSVDILDVLPSDPFGMDINNTFTAITGWLEDLEDDYNNQYGRRRRDDIWIGDGNRQQLFAGLSFFWNNAMQFQSSGYSYGSESLFGGAFDGSLFSTCKFPESSGENNGFGGALDGDGSCHGAFISASSVDEVLSHENARNGEVVGSSDRCNNGEEDAYVHPAIGFCLYHLRGKDLLSVSMVCKSLHTTVCDDTLLWKHIHICRPLNEKITEEALLHLTERAQGTMQCLRIVDCCRITDDCLKRVVARNRQVVKIGVPGCTRITIDGILSVLRDLKSAGKLQVKHLQLRGLFGVTKDHYDELIDLLNIDNKVKQTIQKPRFYHRGEACVSCDDDRALDIEMCPKCQNFKLVYDCPAEDCKGKKKGSEECRACSLCIQRCYHCGRCIIDTEYEEMFCLELLCAVCSKPTPKLTL ski28_arath F-box protein SKIP28 SKIP28 At2g01620 MEE11 SKP1-interacting partner 28 Protein MATERNAL EFFECT EMBRYO ARREST 11 T8O11.21 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKTELEEEEEEEWRSVHEVLLIVLPYLHSLFELLSMIRVSRSLRDAIRDETALWTKLVIEPPLSSRLTDDILSEFSSKSAGKLKTLILRQCLMVTNKGLRRVVDANPLITKIIVPGCSGLTPEGIMECVESLSKNNHKLETLHINGVNGFTKQHLSALYTYLSSEGTIDLEVCPKCDEVRMIPSCSRESCNQKQRKCRGCWLCIPRCAECAVCLVGSDTESQEAACGNDDVLCLECWLVLPKCRFCNKPYCTNHSSRRHEIAITDAASRPSFECEACYYRAGTNPYEVDYQI p2a14_arath F-box protein PP2-A14 Protein PHLOEM PROTEIN 2-LIKE A14 At5g52120 PP2A14 MSG15.23 SKIP13 SKP1-interacting partner 13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGAASSSIVRSEPFAGKLCGLEDVPENCITAMFMYMEPPEICLLARVNKSFHRASRSDAVWEDKLPSNYKFLVRRILEDQQQVGVKDKLIYRKKEIYARLCRPNLFDTGTKEAWLDKRSGKVFLAISPKAMKITGIDDRRYWEHISSDESRFGSITYLRQIWWLEAVGKIRFEFAPGKYSLLFKIQLGKPIRKCGRKTCSLDQVHGWDIKPVRFQLSTSDGQCAMSERHLDESGRWVYHHAGDFVVENQNSPVWVKFSMLQIDCTHTKGGLCLDCVIICPFEYRGKYKYSD skip1_arath F-box protein SKIP1 SKP1-interacting partner 1 SKIP1 MTI20.16 At5g57900 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEDGSDWGGLAPEILINIISRLTIQELWTGPMFVQKSWLTVCRDPYLWSIFDLEPWFDSYPESTHLWSPEFEQKVDLMLRSVVDWSEGGLTKIRVRHCSDHALSYAADRCPNLQVLAIRSSPNVTDASMTKIAFRCRSLKELDISYCHEISHDTLVMIGRNCPNLRILKRNLMDWSSRHIGSVPTEYLDACPQDGDTEADAIGKHMINLEHLEIQFSRLSVKGLASICEGCPKLEYLDLFGCVHLSSRDITSNVSRLKWLKEVKKPDVYVPRSGDVAQTERYGHWRLYDERFDIQAMRI tir1_arath Protein TRANSPORT INHIBITOR RESPONSE 1 TIR1 FBL1 WEI1 T20O10.80 At3g62980 Weak ethylene-insensitive protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAVSPATVIRRFPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLASEVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGYTAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTLNLSYATVQSYDLVKLLCQCPKLQRLWVLDYIEDAGLEVLASTCKDLRELRVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITIARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSGLLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRDCPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVIDERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQIITTNGL p2a13_arath F-box protein PP2-A13 Protein PHLOEM PROTEIN 2-LIKE A13 PP2A13 At3g61060 T27I15.150 SKIP9 SKP1-interacting partner 9 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGANISGGSPEFDRNDDVYSRKLRLVDLPENCVALIMTRLDPPEICRLARLNRMFRRASSADFIWESKLPANYRVIAHKVFDEITLTKLIKKDLYAKLSQPNLFDDGTKELWIDKNTGRLCLSISSKALRITGIDDRRYWSHIPTDESRFQSAAYVQQIWWFEVGGEFEIQFPSGTYSLFFRIQLGKTSKRLGRRICNSEHIHGWDIKPVRFQLATSDNQQAVSLCYLNNNPGSWSHYHVGDFKVTNPDVSTGIKFSMTQIDCTHTKGGLCIDSVLILPKECAKEVIGSQ ado1_arath Adagio protein 1 ADO1 FKL2 Protein ZEITLUPE Clock-associated PAS protein ZTL LOV kelch protein 1 Flavin-binding kelch repeat F-box protein 1-like protein 2 F-box only protein 2b LKP1 ZTL MSF19.2 At5g57360 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEWDSGSDLSADDASSLADDEEGGLFPGGGPIPYPVGNLLHTAPCGFVVTDAVEPDQPIIYVNTVFEMVTGYRAEEVLGGNCRFLQCRGPFAKRRHPLVDSMVVSEIRKCIDEGIEFQGELLNFRKDGSPLMNRLRLTPIYGDDDTITHIIGIQFFIETDIDLGPVLGSSTKEKSIDGIYSALAAGERNVSRGMCGLFQLSDEVVSMKILSRLTPRDVASVSSVCRRLYVLTKNEDLWRRVCQNAWGSETTRVLETVPGAKRLGWGRLARELTTLEAAAWRKLSVGGSVEPSRCNFSACAVGNRVVLFGGEGVNMQPMNDTFVLDLNSDYPEWQHVKVSSPPPGRWGHTLTCVNGSNLVVFGGCGQQGLLNDVFVLNLDAKPPTWREISGLAPPLPRSWHSSCTLDGTKLIVSGGCADSGVLLSDTFLLDLSIEKPVWREIPAAWTPPSRLGHTLSVYGGRKILMFGGLAKSGPLKFRSSDVFTMDLSEEEPCWRCVTGSGMPGAGNPGGVAPPPRLDHVAVNLPGGRILIFGGSVAGLHSASQLYLLDPTEDKPTWRILNIPGRPPRFAWGHGTCVVGGTRAIVLGGQTGEEWMLSELHELSLASYLT ski19_arath F-box protein SKIP19 SKIP19 At4g05460 C6L9.140 FBL20 SKP1-interacting partner 19 F-box/LRR-repeat protein 20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSSSPPAAMEVGESTNWTELPPELTSAILHRLGAIEILENAQKVCRSWRRVCKDPSMWRKIDMHNLGDLDDMDYNLEIMCRHAVDRSQGGLVDIGIWYFGTVDLLNYIAHRSSNLRSLRLIRCSQITDDGFVEAVVKLPLEELELSYCSFSVESLRVVGQCCLNMKTLKLNKHPQKENDDDALAIAETMPKLRHLQLCGNGLSDTGLNAILDNCSNLEHLDLRRCFNVNLVGDLQKRCFESVKVVRHPNDSIHDIDIGSSEDEDPYDFSDIDLMSGDDDFEGYYDFSGASDFSDYDQFDF fbx6_arath F-box only protein 6 At1g27340 FBX6 F17L21.13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEELAMLRQLIGQLQELLHNGSPPPPSSSSSLSSSSPSFLVLHHPQYQNGWCLPCIEDTSADDCCDIVMAGGKRPGIFKMLETVKPPVKRTRKERTQGKSCTEVDEISGNMDQEIWQEFPQDLFEDVVSRLPMATFFQFRAVCRKWNALIDSDSFSRCFTELPQTIPWFYTITHENVNSGQVYDPSLKKWHHPIIPALPKKSIVLPMASAGGLVCFLDIGHRNFYVSNPLTKSFRELPARSFKVWSRVAVGMTLNGNSTSHGYKVLWVGCEGEYEVYDSLSNVWTKRGTIPSNIKLPVLLNFKSQPVAIHSTLYFMLTDPEGILSYDMVSGKWKQFIIPGPPDLSDHTLAACGERLMLVGLLTKNAATCVCIWELQKMTLLWKEVDRMPNIWCLEFYGKHIRMNCLGNKGCLILLSLRSRQMNRLITYNAVTREWTKVPGCTVPRGRKRLWIACGTAFHPSPTARA ski17_arath F-box protein SKIP17 SKIP17 T5J8.4 At4g02740 SKP1-interacting partner 17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPPTQSHNSVRTVPGSNHSHTDLIISSFLSFPDSSPISISNSFDRVLDRALASASADESVQDRLVDRTLELASLLLDSTRRCFRKRASVHNSNSWSLPPELTIKVFSMLDTKSMMQAAVCCTMFNKCAMDRLCYSHIDLTTSARYADKGVVSTMINRAGKELRSLKLGRVVRTAGSDSAAPLLSGSCLSPLAYNHGFLGSRLRSLRLYNLRPIKYRSLCDALSVCPNITDLRIVGLYNLTEELFNSLTKKCRLIEHLFLETYGYPRTLESKAGSSLVEFVTNCPNLTSLTLIRFGLTDDWARNLAESCRKLKYLNLSRSPTIKGRFLRELGLSCKENLLKTLILRSCPKLQEKEVLEFCNSLLTGNFKSIRQIDVSSNSGLASSDRGKRCNKPNFPLERLKEERSDVTFVADFPSTSSGKRYGVCDEEELRLIEMMEAEDDEVDEEDDSDDDTDDVSDEDESENDDDMGMGFDVDYLL ufo_arath Protein UNUSUAL FLORAL ORGANS F-box only protein 1 UFO At1g30950 F17F8.16 FBX1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDSTVFINNPSLTLPFSYTFTSSSNSSTTTSTTTDSSSGQWMDGRIWSKLPPPLLDRVIAFLPPPAFFRTRCVCKRFYSLLFSNTFLETYLQLLPLRHNCFLFFKHKTLKSYIYKRGGTNDDDSNKAEGFLFDPNEIRWYRLSFAYIPSGFYPSGSSGGLVSWVSEEAGLKTILLCNPLVGSVSQLPPISRPRLFPSIGLSVTPTSIDVTVAGDDLISPYAVKNLSSESFHVDAGGFFSLWAMTSSLPRLCSLESGKMVYVQGKFYCMNYSPFSVLSYEVTGNRWIKIQAPMRRFLRSPSLLESKGRLILVAAVEKSKLNVPKSLRLWSLQQDNATWVEIERMPQPLYTQFAAEEGGKGFECVGNQEFVMIVLRGTSLQLLFDIVRKSWLWVPPCPYSGSGGGSSGGGSDGEVLQGFAYDPVLTTPVVSLLDQLTLPFPGVC ski15_arath SKP1-interacting partner 15 SKIP15 F22K20.2 At1g76920 FBX3 F-box only protein 3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESSPVNCLPPDSLHQIFSSLPIRDIMICRSVCKFFNQLLTSQCFIEIISTRPPLNLLALRPPHHHHSHRHSGNGHATNIRPYIHVYDPEQNQWFRFNLDFLPFRSPQPVASSSGLIYLWGDSIDLAESSKSLVACNPLTRQFKVLPQLGSAWSRHGTVLVDSVNRVMVLTELAALYYSGTVVANQWLKFSSNLPSKPRSPVLMSSSVFALCDVGSPWRSQWKLFSCKLTNLTITHTNWVCLEKHEWGDIFDIIKRPRLLRGNGDSKLLMIGGLKSTFSLNPACSTILILRLDLESLEWEEAGRMPLEMYRGFQESSKFKVFGGGDRVYFSAKRMGKLAMWDCWQGWRWIEGVPGYADGLCRGFVFDAKLTLMP fbw2_arath F-box protein FBW2 FBW2 T3H13.1 At4g08980 SKIP18 SKP1-interacting partner 18 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEDCEFRHWDELIPDALGLIFSHLPLQEVLTVVPRVCKAWNRAVTGPYCWQEIDIELWSNRFHQSDHLDRMLEMLIPRSAGSLRKLSVTGLRNDSIFSFIAQHAGSLKTLKVPRSGLTNSGVVNVAEKLSSLTFLDLSYCCKIGPEAIQAIGKHCKSLREFCRNMHPLDVASVVSHDDEAYAIANTMPKLKRLEIAYHRVSTEGVLKILSCCVFLEFLELRGCWDVQLDNKFFKEKFPDMKVLGPRVIGFYDMINDWEDCCSDYFSDGSDYLAWEFFEDGVMGEFYEDEFEHGWDDNFYAENAVLDMEPHIWPPSP ask11_arath SKP1-like protein 11 ASK11 At4g34210 F10M10.2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSKMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVADGIPLANVESKILVKVIEYCKKHHVDEANPISEEDLNNWDEKFMDLEQSTIFELILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRSTFNIENDFTPEEEEAVRKENQWAFE virf_agrt9 Protein VirF virF protein protein agrt9 Agrobacterium tumefaciens (strain 15955) MRNSSLRDASGSNDAQVPHKTELLNLPDHVLTEVAKRLATNNPVESAENIANFSKSHRFTRDAVRTEPLEKFSSRLKILSRNAKLLSHAVRHAATLPDGEQLSEAQLSQMRSEVATRPVLGVAYTHQDGQPEERLSGNHLDHKINNIPNLVFNVAEPIMFNEISALEVMAEVRPIARSIKTAHDDARAELMSADRPRSTRGL skp1b_arath SKP1-like protein 1B SKP1-like 2 UFO-binding protein 2 ASK2 UIP2 At5g42190 MJC20.30 SKP1B protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTVRKITLKSSDGENFEIDEAVALESQTIKHMIEDDCTDNGIPLPNVTSKILSKVIEYCKRHVEAAEKSETTADAAAATTTTTVASGSSDEDLKTWDSEFIKVDQGTLFDLILAANYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE ask3_arath SKP1-like protein 3 ASK3 At2g25700 F3N11.15 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAETKKMIILKSSDGESFEVEEAVAVESQTIKHMIEDDCVDNGIPLPNVTGAILAKVIEYCKKHVEAAAEAGGDKDFYGSTENHELKTWDNDFVKVDHPTLFDLLRAANYLNISGLLDLTCKAVADQMRGKTPAQMREHFNIKNDYTPEEEAEVRNENRWAFE ask9_arath SKP1-like protein 9 At3g21850 ASK9 MSD21.22 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTKKIILKSSDGHSFEVEEEAARQCQIIIAHMSENDCTDNGIPLPNVTGKILAMVIEYCNKHHVDAANPCSDDDLKKWDKEFMEKDTSTIFDLIKAANYLNIKSLFDLACQTVAEIIKGNTPEQIREFFNIENDLTPEEEAAIRRENKWAFE ask12_arath SKP1-like protein 12 ASK12 T4L20.50 At4g34470 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSKMIVLMSSDGQSFEVEEAVAIQSQTIAHMVEDDCVADGIPLANVESKILVKVIEYCKKYHVDEANPISEEDLNKWDEKFMDLEQSTIFELILAANYLNIKSLFDLTCQTVADMIKGKTPEEIRSTFNIENDFTPEEEEAVRKENQWAFE ask4_arath SKP1-like protein 4 T20H2.8 At1g20140 ASK4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAETKKMIILKSSDGESFEIEEAVAVKSQTIKHMIEDDCADNGIPLPNVTGAILAKVIEYCKKHVEAAAEAGGDKDFYGSAENDELKNWDSEFVKVDQPTLFDLILAANYLNIGGLLDLTCKAVADQMRGKTPEQMRAHFNIKNDYTPEEEAEVRNENKWAFE ask19_arath SKP1-like protein 19 At2g03160 ASK19 T18E12.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSKKIVLTSSDGESFKVEEVVARKLQIVGHIIEDDCATNKIPIPNVTGEILAKVIEYCKKHVEDDDDVVETHESSTKGDKTVEEAKKKPDDVAVPESTEGDDEAEDKKEKLNEWDAKFMKDFDIKTIFDIILAANYLNVQGLFDLCSKTIADYIKDMTPEEVRELFNIENDFTPEEEEAIRNENAWTFEQDGKQQVPKP ask14_arath SKP1-like protein 14 At2g03170 ASK14 T18E12.16 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSNKIVLSSSDGESFEVEEAVARKLKIVEHMIEDDCVVTEVPLQNVTGKILSIVVEYCKKHVVDEESDEFKTWDEEFMKKFDQPTVFQLLLAANYLNIKGLLDLSAQTVADRIKDKTPEEIREIFNIENDFTPEEEAAVRKENAWAFE ask7_arath SKP1-like protein 7 At3g21840 ASK7 MSD21.21 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTKKIMLKSSDGKMFEIEEETARQCQTIAHMIEAECTDNVIPVSNVTSEILEMVIEYCNKHHVDAANPCSDEDLKKWDKEFMEKDQYTIFHLMNAAYDLHIKSLLALAYQTVADMVNDNKWAFE ask8_arath SKP1-like protein 8 At3g21830 ASK8 MSD21.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSTKKIMLKSSEGKTFEIEEETARQCQTIAHMIEAECTDNVILVLKMTSEILEMVIEYCNKHHVDAANPCSDDDLEKWDKEFMEKDKSTIFALTNAANFLNNKSLLHLAGQTVADMIKGNTPKQMREFFNIENDLTPEEEAAIRRENKWAFE ask18_arath SKP1-like protein 18 At1g10230 F14N23.11 ASK18 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSNKILLTSSDGESFEIDEAVARKFLIIVHMMEDNCAGEAIPLENVTGDILSKIIEYAKMHVNEPSEEDEDEEAKKNLDSWDAKFMEKLDLETIFKIILAANYLNFEGLLGFASQTVADYIKDKTPEEVREIFNIENDFTPEEEEEIRKENAWTFNE ask15_arath SKP1-like protein 15 ASK15 T5M7.16 At3g25650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSNKIVLTSSDGESFQVEEVVARKLQIVKHLLEDDCVINEIPLQNVTGNILSIVLEYCKKHVDDVVDDDASEEPKKKKPDDEAKQNLDAWDAEFMKNIDMETIFKLILAANYLNVEGLLGLTCQTVADYIKDKTPEEVRELFNIENDFTHEEEEEAIRKENAWAFEADTKHEDPKP q8jzk2_9zzzz SKL1 protein protein uni unidentified MADSTAAQDAPRQEEDARKVNLVSMDGDSFEVSRSVASMSELVKTLISDEQEDDEVQEIPLPNVKSTVLSKVIEFCSHHHNNPMREIEKPLKSSDMHDVVSDWDANFVDIEQDILFELILAANYMDIKSLLDLACAKVASMIKGKTPQEIRETFNIVNDFTPEEESQIREENKWCEEA ask13_arath SKP1-like protein 13 ASK13 At3g60010 F24G16.280 T2O9.1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKMVMLLSSDGESFQVEEAVAVQSQTIAHMIEDDCVANGVPIANVTGVILSKVIEYCKKHVVSDSPTEESKDELKKWDAEFMKALEQSSTLFDVMLAANYLNIKDLLDLGCQTVADMITGKKPDEIRALLGIENDFTPEEEEEIRKENQWAFE skp1_yeast Suppressor of kinetochore protein 1 SKP1 CBF3D YDR328C D9798.14 Centromere DNA-binding protein complex CBF3 subunit D E3 ubiquitin ligase complex SCF subunit SKP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSKDNNNGDDDDEDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDSWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEEEAAIRRENEWAEDR 746DDE6470A69432 ask17_arath SKP1-like protein 17 At2g20160 ASK17 MEO Protein MEIDOS T2G17.4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSKKIVLTSSDDECFEIDEAVARKMQMVAHMIDDDCADKAIRLQNVTGKILAIIIEYCKKHVDDVEAKNEFVTWDAEFVKNIDMDTLFKLLDAADYLIVIGLKNLIAQAIADYTADKTVNEIRELFNIENDYTPEEEEELRKKNEWAFN q9c5t5_arath ASK10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress TRPGQRKVRLTSSDGETFEVERDVIALSTTLNTMMMDLGLDNADAEMDAVPLQNVAGPILRKVLLWCTSHKDDPPSADDDNREKRTDDIPSWDVEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRRTFNIKNDFTPEEEEQIRRENAWCED ask1-skip13-1 Yeast 2 hybrid analysis reveals interaction between ASK1 protein and the SKIP13 protein 190013 N/A 190015 unspecified role unspecified role bait bait N/A 190016 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ask1-skip1-1 Yeast 2 hybrid analysis reveals interaction between ASK1 protein and the SKIP1 protein 190013 N/A 190015 unspecified role unspecified role bait bait N/A 190017 unspecified role unspecified role prey prey physical association physical association false false false ask1-skip14-1 Yeast 2 hybrid analysis reveals interaction between ASK1 protein and the SKIP14 protein 190013 N/A 190015 unspecified role unspecified role bait bait N/A 190018 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ask1-skip28-1 Yeast 2 hybrid analysis reveals interaction between ASK1 protein and the SKIP28 protein 190013 N/A 190015 unspecified role unspecified role bait bait N/A 190019 unspecified role unspecified role prey prey physical association physical association false false false ask1-ztl Yeast 2 hybrid analysis reveals interaction between ASK1 protein and the ZTL protein 190013 N/A 190020 unspecified role unspecified role prey prey N/A 190015 unspecified role unspecified role bait bait physical association physical association false false false ztl-ask1-5 Yeast 2 hybrid analysis reveals interaction between ZTL protein and the ASK1 protein 190013 N/A 190020 unspecified role unspecified role prey prey N/A 190015 unspecified role unspecified role bait bait physical association physical association false false false ask1-skip19 Yeast 2 hybrid analysis reveals interaction between ASK1 protein and the SKIP19 protein 190013 N/A 190021 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 190015 unspecified role unspecified role bait bait physical association physical association false false false tir1-ask1-3 Yeast 2 hybrid analysis reveals interaction between TIR1 protein and the ASK1 protein 190013 N/A 190015 unspecified role unspecified role prey prey N/A 190022 unspecified role unspecified role bait bait physical association physical association false false false ask1-skip9-1 Yeast 2 hybrid analysis reveals interaction between ASK1 protein and the SKIP9 protein 190013 N/A 190015 unspecified role unspecified role bait bait N/A 190023 unspecified role unspecified role prey prey physical association physical association false false false ufo-ask1-1 Yeast 2 hybrid analysis reveals interaction between UNUSUAL FLORAL ORGANS (UFO) protein and ASK1 protein 190013 N/A 190024 unspecified role unspecified role bait bait N/A 190015 unspecified role unspecified role prey prey physical association physical association false false false ask1-ufo Yeast 2 hybrid analysis reveals interaction between the ASK1 protein and the UNUSUAL FLORAL ORGANS (UFO) protein 190013 N/A 190024 unspecified role unspecified role prey prey N/A 190015 unspecified role unspecified role bait bait physical association physical association false false false ask1-skip15-1 Yeast 2 hybrid analysis reveals interaction between ASK1 protein and the SKIP15 protein 190013 N/A 190025 unspecified role unspecified role prey prey N/A 190015 unspecified role unspecified role bait bait physical association physical association false false false skip15-ask1 Yeast 2 hybrid analysis reveals interaction between the SKIP15 protein and the ASK1 protein 190013 N/A 190025 unspecified role unspecified role bait bait N/A 190015 unspecified role unspecified role prey prey physical association physical association false false false ask1-q9fzk1 Yeast 2 hybrid analysis reveals interaction between ASK1 protein and the Q9FZK1 protein 190013 N/A 190026 unspecified role unspecified role prey prey N/A 190015 unspecified role unspecified role bait bait physical association physical association false false false q9fzk1-ask1 Yeast 2 hybrid analysis reveals interaction betweenthe Q9FZK1 protein and the ASK1 protein 190013 N/A 190026 unspecified role unspecified role bait bait N/A 190015 unspecified role unspecified role prey prey physical association physical association false false false ask1-skip17 Yeast 2 hybrid analysis reveals interaction between ASK1 protein and the SKIP17 protein 190013 N/A 190027 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 190015 unspecified role unspecified role bait bait physical association physical association false false false skip17-ask1 Yeast 2 hybrid analysis reveals interaction between the SKIP17 protein and the ASK1 protein 190013 N/A 190027 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 190015 unspecified role unspecified role prey prey physical association physical association false false false virf-ask1-1 Yeast 2 hybrid analysis reveals interaction between the VirF protein of Agrobacterium tumifaciens and the ASK1 protein 190013 N/A 190015 unspecified role unspecified role prey prey N/A 190028 unspecified role unspecified role bait bait physical association physical association false false false ask1-virf Yeast 2 hybrid analysis reveals interaction between the ASK1 protein and the VirF protein of Agrobacterium tunifaciens 190013 N/A 190015 unspecified role unspecified role prey prey N/A 190028 unspecified role unspecified role bait bait physical association physical association false false false ask2-ztl-1 Yeast 2 hybrid analysis reveals interaction between ASK2 protein and the ZTL protein 190013 N/A 190020 unspecified role unspecified role prey prey N/A 190029 unspecified role unspecified role bait bait physical association physical association false false false ztl-ask2 Yeast 2 hybrid analysis reveals interaction between the ZTL protein and the ASK2 protein 190013 N/A 190029 unspecified role unspecified role prey prey N/A 190020 unspecified role unspecified role bait bait physical association physical association false false false ask2-skip9-1 Yeast 2 hybrid analysis reveals interaction between ASK2 protein and the SKIP9 protein 190013 N/A 190023 unspecified role unspecified role prey prey N/A 190029 unspecified role unspecified role bait bait physical association physical association false false false ask12-skip13 Yeast 2 hybrid analysis reveals interaction between ASK2 protein and the SKIP13 protein 190013 N/A 190029 unspecified role unspecified role bait bait N/A 190016 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false tir1-ask2-3 Yeast 2 hybrid analysis reveals interaction between TIR1 protein and the ASK2 protein 190013 N/A 190022 unspecified role unspecified role bait bait N/A 190029 unspecified role unspecified role prey prey physical association physical association false false false ask1-skip18 Yeast 2 hybrid analysis reveals interaction between ASK1 protein and the SKIP18 protein 190013 N/A 190030 unspecified role unspecified role prey prey N/A 190015 unspecified role unspecified role bait bait physical association physical association false false false ask2-skip18-1 Yeast 2 hybrid analysis reveals interaction between ASK2 protein and the SKIP18 protein 190013 N/A 190029 unspecified role unspecified role bait bait N/A 190030 unspecified role unspecified role prey prey physical association physical association false false false ask12-skip1 Yeast 2 hybrid analysis reveals interaction between ASK2 protein and the SKIP1 protein 190013 N/A 190029 unspecified role unspecified role bait bait N/A 190017 unspecified role unspecified role prey prey physical association physical association false false false ask2-skip19-1 Yeast 2 hybrid analysis reveals interaction between ASK2 protein and the SKIP19 protein 190013 N/A 190029 unspecified role unspecified role bait bait N/A 190021 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ufo-ask2-1 Yeast 2 hybrid analysis reveals interaction between UNUSUAL FLORAL ORGANS (UFO) protein and ASK2 protein 190013 N/A 190029 unspecified role unspecified role prey prey N/A 190024 unspecified role unspecified role bait bait physical association physical association false false false ask2-ufo Yeast 2 hybrid analysis reveals interaction between the ASK2 protein and the UNUSUAL FLORAL ORGANS (UFO) protein 190013 N/A 190024 unspecified role unspecified role prey prey N/A 190029 unspecified role unspecified role bait bait physical association physical association false false false ask2-skip15-1 Yeast 2 hybrid analysis reveals interaction between ASK2 protein and the SKIP15 protein 190013 N/A 190025 unspecified role unspecified role prey prey N/A 190029 unspecified role unspecified role bait bait physical association physical association false false false skip15-ask2 Yeast 2 hybrid analysis reveals interaction between the SKIP15 protein and the ASK2 protein 190013 N/A 190025 unspecified role unspecified role bait bait N/A 190029 unspecified role unspecified role prey prey physical association physical association false false false ask2-q9fzk1-1 Yeast 2 hybrid analysis reveals interaction between ASK2 protein and the Q9FZK1 protein 190013 N/A 190026 unspecified role unspecified role prey prey N/A 190029 unspecified role unspecified role bait bait physical association physical association false false false ask2-skip17-1 Yeast 2 hybrid analysis reveals interaction between ASK2 protein and the SKIP17 protein 190013 N/A 190029 unspecified role unspecified role bait bait N/A 190027 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false skip17-ask2 Yeast 2 hybrid analysis reveals interaction between the SKIP17 protein and the ASK2 protein 190013 N/A 190029 unspecified role unspecified role prey prey N/A 190027 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ask2-skip14-1 Yeast 2 hybrid analysis reveals interaction between ASK2 protein and the SKIP14 protein 190013 N/A 190029 unspecified role unspecified role bait bait N/A 190018 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ask2-skip28-1 Yeast 2 hybrid analysis reveals interaction between ASK2 protein and the SKIP28 protein 190013 N/A 190029 unspecified role unspecified role bait bait N/A 190019 unspecified role unspecified role prey prey physical association physical association false false false ask2-virf Yeast 2 hybrid analysis reveals interaction between the ASK2 protein and the VirF protein of Agrobacterium tunifaciens 190013 N/A 190029 unspecified role unspecified role bait bait N/A 190028 unspecified role unspecified role prey prey physical association physical association false false false virf-ask2 Yeast 2 hybrid analysis reveals interaction between the VirF protein of Agrobacterium tumifaciens and the ASK2 protein 190013 N/A 190029 unspecified role unspecified role prey prey N/A 190028 unspecified role unspecified role bait bait physical association physical association false false false ask11-ztl-1 Yeast 2 hybrid analysis reveals interaction between ASK11 protein and the ZTL protein 190013 N/A 190031 unspecified role unspecified role bait bait N/A 190020 unspecified role unspecified role prey prey physical association physical association false false false ztl-ask11 Yeast 2 hybrid analysis reveals interaction between the ZTL protein and the ASK11 protein 190013 N/A 190020 unspecified role unspecified role bait bait N/A 190031 unspecified role unspecified role prey prey physical association physical association false false false ask11-skip9-2 Yeast 2 hybrid analysis reveals interaction between ASK11 protein and the SKIP9 protein 190013 N/A 190023 unspecified role unspecified role prey prey N/A 190031 unspecified role unspecified role bait bait physical association physical association false false false ask11-skip13 Yeast 2 hybrid analysis reveals interaction between ASK11 protein and the SKIP13 protein 190013 N/A 190016 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 190031 unspecified role unspecified role bait bait physical association physical association false false false tir1-ask11 Yeast 2 hybrid analysis reveals interaction between TIR1 protein and the ASK11 protein 190013 N/A 190031 unspecified role unspecified role prey prey N/A 190022 unspecified role unspecified role bait bait physical association physical association false false false ask11-tir1 Yeast 2 hybrid analysis reveals interaction between the ASK11 protein and the TIR1 protein and 190013 N/A 190031 unspecified role unspecified role bait bait N/A 190022 unspecified role unspecified role prey prey physical association physical association false false false ask11-skip18 Yeast 2 hybrid analysis reveals interaction between ASK11 protein and the SKIP18 protein 190013 N/A 190030 unspecified role unspecified role prey prey N/A 190031 unspecified role unspecified role bait bait physical association physical association false false false ask11-skip1 Yeast 2 hybrid analysis reveals interaction between ASK11 protein and the SKIP1 protein 190013 N/A 190031 unspecified role unspecified role bait bait N/A 190017 unspecified role unspecified role prey prey physical association physical association false false false ask11-skip19 Yeast 2 hybrid analysis reveals interaction between ASK11 protein and the SKIP19 protein 190013 N/A 190031 unspecified role unspecified role bait bait N/A 190021 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ufo-ask11-1 Yeast 2 hybrid analysis reveals interaction between UNUSUAL FLORAL ORGANS (UFO) protein and ASK11 protein 190013 N/A 190031 unspecified role unspecified role prey prey N/A 190024 unspecified role unspecified role bait bait physical association physical association false false false ask11-ufo Yeast 2 hybrid analysis reveals interaction between ASK11 protein and the UNUSUAL FLORAL ORGANS (UFO) protein 190013 N/A 190024 unspecified role unspecified role prey prey N/A 190031 unspecified role unspecified role bait bait physical association physical association false false false ask11-skip15 Yeast 2 hybrid analysis reveals interaction between ASK1 protein and the SKIP15 protein 190013 N/A 190025 unspecified role unspecified role prey prey N/A 190031 unspecified role unspecified role bait bait physical association physical association false false false skip15-ask11 Yeast 2 hybrid analysis reveals interaction between the SKIP15 protein and the ASK1 protein 190013 N/A 190031 unspecified role unspecified role prey prey N/A 190025 unspecified role unspecified role bait bait physical association physical association false false false ask11-q9fzk1 Yeast 2 hybrid analysis reveals interaction between ASK11 protein and the Q9FZK1 protein 190013 N/A 190031 unspecified role unspecified role bait bait N/A 190026 unspecified role unspecified role prey prey physical association physical association false false false q9fzk1-ask11 Yeast 2 hybrid analysis reveals interaction between the Q9FZK1 protein and the ASK11 protein 190013 N/A 190026 unspecified role unspecified role bait bait N/A 190031 unspecified role unspecified role prey prey physical association physical association false false false ask11-skip17 Yeast 2 hybrid analysis reveals interaction between ASK11 protein and the SKIP17 protein 190013 N/A 190031 unspecified role unspecified role bait bait N/A 190027 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false skip17-ask11 Yeast 2 hybrid analysis reveals interaction between the SKIP17 protein and the ASK11 protein 190013 N/A 190027 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 190031 unspecified role unspecified role prey prey physical association physical association false false false ask11-skip14 Yeast 2 hybrid analysis reveals interaction between ASK11 protein and the SKIP14 protein 190013 N/A 190031 unspecified role unspecified role bait bait N/A 190018 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ask11-skip28 Yeast 2 hybrid analysis reveals interaction between ASK11 protein and the SKIP28 protein 190013 N/A 190019 unspecified role unspecified role prey prey N/A 190031 unspecified role unspecified role bait bait physical association physical association false false false ask11-virf-1 Yeast 2 hybrid analysis reveals interaction between the ASK11 protein and the VirF protein of Agrobacterium tunifaciens 190013 N/A 190031 unspecified role unspecified role bait bait N/A 190028 unspecified role unspecified role prey prey physical association physical association false false false virf-ask11 Yeast 2 hybrid analysis reveals interaction between the VirF protein of Agrobacterium tunifaciens and the ASK11 protein 190013 N/A 190028 unspecified role unspecified role bait bait N/A 190031 unspecified role unspecified role prey prey physical association physical association false false false ztl-ask12 Yeast 2 hybrid analysis reveals interaction between the ZTL protein and the ASK12 protein 190013 N/A 190032 unspecified role unspecified role prey prey N/A 190020 unspecified role unspecified role bait bait physical association physical association false false false ufo-ask12 Yeast 2 hybrid analysis reveals interaction between UNUSUAL FLORAL ORGANS (UFO) protein and ASK12 protein 190013 N/A 190024 unspecified role unspecified role bait bait N/A 190032 unspecified role unspecified role prey prey physical association physical association false false false skip15-ask12 Yeast 2 hybrid analysis reveals interaction between the SKIP15 protein and the ASK12 protein 190013 N/A 190025 unspecified role unspecified role bait bait N/A 190032 unspecified role unspecified role prey prey physical association physical association false false false ask12-q9fzk1 Yeast 2 hybrid analysis reveals interaction between ASK12 protein and the Q9FZK1 protein 190013 N/A 190032 unspecified role unspecified role bait bait N/A 190026 unspecified role unspecified role prey prey physical association physical association false false false skip17-ask12 Yeast 2 hybrid analysis reveals interaction between the SKIP17 protein and the ASK12 protein 190013 N/A 190032 unspecified role unspecified role prey prey N/A 190027 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false virf-ask12 Yeast 2 hybrid analysis reveals interaction between the VirF protein of Agrobacterium tumifaciens and the ASK12 protein 190013 N/A 190028 unspecified role unspecified role bait bait N/A 190032 unspecified role unspecified role prey prey physical association physical association false false false ask4-skip18 Yeast 2 hybrid analysis reveals interaction between ASK4 protein and the SKIP18 protein 190013 N/A 190030 unspecified role unspecified role prey prey N/A 190033 unspecified role unspecified role bait bait physical association physical association false false false ask4-skip15 Yeast 2 hybrid analysis reveals interaction between ASK4 protein and the SKIP15 protein 190013 N/A 190025 unspecified role unspecified role prey prey N/A 190033 unspecified role unspecified role bait bait physical association physical association false false false skip15-ask4 Yeast 2 hybrid analysis reveals interaction between the SKIP15 protein and the ASK4 protein 190013 N/A 190025 unspecified role unspecified role bait bait N/A 190033 unspecified role unspecified role prey prey physical association physical association false false false ask4-skip17 Yeast 2 hybrid analysis reveals interaction between ASK4 protein and the SKIP17 protein 190013 N/A 190033 unspecified role unspecified role bait bait N/A 190027 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false skip17-ask4 Yeast 2 hybrid analysis reveals interaction between the SKIP17 protein and the ASK4 protein 190013 N/A 190027 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 190033 unspecified role unspecified role prey prey physical association physical association false false false ask4-skip14 Yeast 2 hybrid analysis reveals interaction between ASK4 protein and the SKIP14 protein 190013 N/A 190033 unspecified role unspecified role bait bait N/A 190018 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ask4-skip28 Yeast 2 hybrid analysis reveals interaction between ASK4 protein and the SKIP28 protein 190013 N/A 190033 unspecified role unspecified role bait bait N/A 190019 unspecified role unspecified role prey prey physical association physical association false false false ztl-ask3 Yeast 2 hybrid analysis reveals interaction between the ZTL1 protein and the ASK3 protein 190013 N/A 190034 unspecified role unspecified role prey prey N/A 190020 unspecified role unspecified role bait bait physical association physical association false false false skip14-ask3 Yeast 2 hybrid analysis reveals interaction between the SKIP14 protein and the ASK3 protein 190013 N/A 190018 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 190034 unspecified role unspecified role prey prey physical association physical association false false false ztl-ask9 Yeast 2 hybrid analysis reveals interaction between the ZTL protein and the ASK9 protein and 190013 N/A 190035 unspecified role unspecified role prey prey N/A 190020 unspecified role unspecified role bait bait physical association physical association false false false ask9-skip13 Yeast 2 hybrid analysis reveals interaction between ASK9 protein and the SKIP13 protein 190013 N/A 190016 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 190035 unspecified role unspecified role bait bait physical association physical association false false false ask9-tir1 Yeast 2 hybrid analysis reveals interaction between the ASK9 protein and the TIR1 protein and 190013 N/A 190022 unspecified role unspecified role prey prey N/A 190035 unspecified role unspecified role bait bait physical association physical association false false false ask9-skip15 Yeast 2 hybrid analysis reveals interaction between ASK9 protein and the SKIP15 protein 190013 N/A 190025 unspecified role unspecified role prey prey N/A 190035 unspecified role unspecified role bait bait physical association physical association false false false skip15-ask9 Yeast 2 hybrid analysis reveals interaction between the SKIP15 protein and the ASK9 protein 190013 N/A 190035 unspecified role unspecified role prey prey N/A 190025 unspecified role unspecified role bait bait physical association physical association false false false ask9-q9fzk1 Yeast 2 hybrid analysis reveals interaction between ASK9 protein and the Q9FZK1 protein 190013 N/A 190026 unspecified role unspecified role prey prey N/A 190035 unspecified role unspecified role bait bait physical association physical association false false false skip17-ask9 Yeast 2 hybrid analysis reveals interaction between the SKIP17 protein and the ASK9 protein 190013 N/A 190035 unspecified role unspecified role prey prey N/A 190027 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ztl-ask7 Yeast 2 hybrid analysis reveals interaction between the ZTL protein and the ASK7 protein and 190013 N/A 190020 unspecified role unspecified role bait bait N/A 190036 unspecified role unspecified role prey prey physical association physical association false false false ztl-ask8 Yeast 2 hybrid analysis reveals interaction between the ZTL protein and the ASK8 protein and 190013 N/A 190020 unspecified role unspecified role bait bait N/A 190037 unspecified role unspecified role prey prey physical association physical association false false false ztl-ask19 Yeast 2 hybrid analysis reveals interaction between the ZTL protein and the ASK19 protein and 190013 N/A 190020 unspecified role unspecified role bait bait N/A 190038 unspecified role unspecified role prey prey physical association physical association false false false ask19-skip13 Yeast 2 hybrid analysis reveals interaction between ASK19 protein and the SKIP13 protein 190013 N/A 190038 unspecified role unspecified role bait bait N/A 190016 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false ask19-skip18 Yeast 2 hybrid analysis reveals interaction between the ASK19 protein and the SKIP18 protein 190013 N/A 190030 unspecified role unspecified role prey prey N/A 190038 unspecified role unspecified role bait bait physical association physical association false false false ufo-ask19 Yeast 2 hybrid analysis reveals interaction between UNUSUAL FLORAL ORGANS (UFO) protein and ASK19 protein 190013 N/A 190038 unspecified role unspecified role prey prey N/A 190024 unspecified role unspecified role bait bait physical association physical association false false false skip15-ask19 Yeast 2 hybrid analysis reveals interaction between the SKIP15 protein and the ASK19 protein 190013 N/A 190025 unspecified role unspecified role bait bait N/A 190038 unspecified role unspecified role prey prey physical association physical association false false false q9fzk1-ask19 Yeast 2 hybrid analysis reveals interaction between the Q9FZK1 protein and the ASK19 protein 190013 N/A 190038 unspecified role unspecified role prey prey N/A 190026 unspecified role unspecified role bait bait physical association physical association false false false skip17-ask19 Yeast 2 hybrid analysis reveals interaction between the SKIP17 protein and the ASK19 protein 190013 N/A 190027 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 190038 unspecified role unspecified role prey prey physical association physical association false false false ask14-skip13 Yeast 2 hybrid analysis reveals interaction between ASK14 protein and the SKIP13 protein 190013 N/A 190016 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 190039 unspecified role unspecified role bait bait physical association physical association false false false ask14-ufo Yeast 2 hybrid analysis reveals interaction between the ASK14 protein and the UNUSUAL FLORAL ORGANS (UFO) protein 190013 N/A 190024 unspecified role unspecified role prey prey N/A 190039 unspecified role unspecified role bait bait physical association physical association false false false ask14-skip15 Yeast 2 hybrid analysis reveals interaction between ASK14 protein and the SKIP15 protein 190013 N/A 190039 unspecified role unspecified role bait bait N/A 190025 unspecified role unspecified role prey prey physical association physical association false false false ask14-q9fzk1 Yeast 2 hybrid analysis reveals interaction between ASK14 protein and the Q9FZK1 protein 190013 N/A 190026 unspecified role unspecified role prey prey N/A 190039 unspecified role unspecified role bait bait physical association physical association false false false ask8-virf Yeast 2 hybrid analysis reveals interaction between the ASK8 protein and the VirF protein of Agrobacterium tunifaciens 190013 N/A 190037 unspecified role unspecified role bait bait N/A 190028 unspecified role unspecified role prey prey physical association physical association false false false ask14-skip14 Yeast 2 hybrid analysis reveals interaction between ASK14 protein and the SKIP14 protein 190013 N/A 190018 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 190039 unspecified role unspecified role bait bait physical association physical association false false false ask14-skip28 Yeast 2 hybrid analysis reveals interaction between ASK14 protein and the SKIP28 protein 190013 N/A 190019 unspecified role unspecified role prey prey N/A 190039 unspecified role unspecified role bait bait physical association physical association false false false skl1-q9lsx9 190013 N/A 190035 unspecified role unspecified role prey prey N/A 190040 unspecified role unspecified role bait bait physical association physical association false false false skl1-lkp1 190013 N/A 190020 unspecified role unspecified role prey prey N/A 190040 unspecified role unspecified role bait bait physical association physical association false false false skl1-f24g16_280 190013 N/A 190041 unspecified role unspecified role prey prey N/A 190040 unspecified role unspecified role bait bait physical association physical association false false false skl1-at1g10230 190013 N/A 190042 unspecified role unspecified role prey prey N/A 190040 unspecified role unspecified role bait bait physical association physical association false false false skl1-at2g03160 190013 N/A 190038 unspecified role unspecified role prey prey N/A 190040 unspecified role unspecified role bait bait physical association physical association false false false skl1-q9li78 190013 N/A 190043 unspecified role unspecified role prey prey N/A 190040 unspecified role unspecified role bait bait physical association physical association false false false skl1-at2g20160 190013 N/A 190044 unspecified role unspecified role prey prey N/A 190040 unspecified role unspecified role bait bait physical association physical association false false false skl1-at2g03170 190013 N/A 190039 unspecified role unspecified role prey prey N/A 190040 unspecified role unspecified role bait bait physical association physical association false false false skl1-at2g01620 190013 N/A 190019 unspecified role unspecified role prey prey N/A 190040 unspecified role unspecified role bait bait physical association physical association false false false skl1-virf 190013 N/A 190028 unspecified role unspecified role prey prey N/A 190040 unspecified role unspecified role bait bait physical association physical association false false false lkp1-skl1 190013 N/A 190040 unspecified role unspecified role prey prey N/A 190020 unspecified role unspecified role bait bait physical association physical association false false false ufo-skl1 190013 N/A 190040 unspecified role unspecified role prey prey N/A 190024 unspecified role unspecified role bait bait physical association physical association false false false q9li78-skl1 190013 N/A 190043 unspecified role unspecified role bait bait N/A 190040 unspecified role unspecified role prey prey physical association physical association false false false at2g20160-skl1 190013 N/A 190044 unspecified role unspecified role bait bait N/A 190040 unspecified role unspecified role prey prey physical association physical association false false false ask10-q9lsx9 190013 N/A 190035 unspecified role unspecified role prey prey N/A 190045 unspecified role unspecified role bait bait physical association physical association false false false ask10-lkp1 190013 N/A 190020 unspecified role unspecified role prey prey N/A 190045 unspecified role unspecified role bait bait physical association physical association false false false ask10-f24g16_280 190013 N/A 190041 unspecified role unspecified role prey prey N/A 190045 unspecified role unspecified role bait bait physical association physical association false false false ask10-at1g10230 190013 N/A 190042 unspecified role unspecified role prey prey N/A 190045 unspecified role unspecified role bait bait physical association physical association false false false ask10-at2g03160 190013 N/A 190038 unspecified role unspecified role prey prey N/A 190045 unspecified role unspecified role bait bait physical association physical association false false false ask10-q9li78 190013 N/A 190043 unspecified role unspecified role prey prey N/A 190045 unspecified role unspecified role bait bait physical association physical association false false false ask10-at2g20160 190013 N/A 190044 unspecified role unspecified role prey prey N/A 190045 unspecified role unspecified role bait bait physical association physical association false false false ask10-at2g03170 190013 N/A 190039 unspecified role unspecified role prey prey N/A 190045 unspecified role unspecified role bait bait physical association physical association false false false ask10-at2g01620 190013 N/A 190019 unspecified role unspecified role prey prey N/A 190045 unspecified role unspecified role bait bait physical association physical association false false false ask10-virf 190013 N/A 190028 unspecified role unspecified role prey prey N/A 190045 unspecified role unspecified role bait bait physical association physical association false false false cbf3d-f24g16_280 190013 N/A 190041 unspecified role unspecified role prey prey N/A 190046 unspecified role unspecified role bait bait physical association physical association false false false cbf3d-at2g03160 190013 N/A 190038 unspecified role unspecified role prey prey N/A 190046 unspecified role unspecified role bait bait physical association physical association false false false cbf3d-at1g10230 190013 N/A 190042 unspecified role unspecified role prey prey N/A 190046 unspecified role unspecified role bait bait physical association physical association false false false cbf3d-q9li78 190013 N/A 190043 unspecified role unspecified role prey prey N/A 190046 unspecified role unspecified role bait bait physical association physical association false false false cbf3d-at2g03170 190013 N/A 190039 unspecified role unspecified role prey prey N/A 190046 unspecified role unspecified role bait bait physical association physical association false false false cbf3d-at2g01620 190013 N/A 190019 unspecified role unspecified role prey prey N/A 190046 unspecified role unspecified role bait bait physical association physical association false false false f24g16_280-cbf3d 190013 N/A 190046 unspecified role unspecified role prey prey N/A 190041 unspecified role unspecified role bait bait physical association physical association false false false at2g20160-cbf3d 190013 N/A 190046 unspecified role unspecified role prey prey N/A 190044 unspecified role unspecified role bait bait physical association physical association false false false