DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ mcgowan-2012-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined McGowan S., Buckle AM., Mitchell MS., Hoopes JT., Gallagher DT., Heselpoth RD., Shen Y., Reboul CF., Law RH., Fischetti VA., Whisstock JC., Nelson DC. DIP original experiment: DIP-251737X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx X-ray crystal structure of the streptococcal specific phage lysin PlyC. McGowan S., Buckle AM., Mitchell MS., Hoopes JT., Gallagher DT., Heselpoth RD., Shen Y., Reboul CF., Law RH., Fischetti VA., Whisstock JC., Nelson DC. Only protein-protein interactions imex curation mcgowan-2012-2 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined McGowan S., Buckle AM., Mitchell MS., Hoopes JT., Gallagher DT., Heselpoth RD., Shen Y., Reboul CF., Law RH., Fischetti VA., Whisstock JC., Nelson DC. DIP original experiment: DIP-251738X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx X-ray crystal structure of the streptococcal specific phage lysin PlyC. McGowan S., Buckle AM., Mitchell MS., Hoopes JT., Gallagher DT., Heselpoth RD., Shen Y., Reboul CF., Law RH., Fischetti VA., Whisstock JC., Nelson DC. Only protein-protein interactions imex curation mcgowan-2012-3 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined McGowan S., Buckle AM., Mitchell MS., Hoopes JT., Gallagher DT., Heselpoth RD., Shen Y., Reboul CF., Law RH., Fischetti VA., Whisstock JC., Nelson DC. DIP original experiment: DIP-251739X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx X-ray crystal structure of the streptococcal specific phage lysin PlyC. McGowan S., Buckle AM., Mitchell MS., Hoopes JT., Gallagher DT., Heselpoth RD., Shen Y., Reboul CF., Law RH., Fischetti VA., Whisstock JC., Nelson DC. Only protein-protein interactions imex curation mcgowan-2012-4 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined McGowan S., Buckle AM., Mitchell MS., Hoopes JT., Gallagher DT., Heselpoth RD., Shen Y., Reboul CF., Law RH., Fischetti VA., Whisstock JC., Nelson DC. DIP original experiment: DIP-251740X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx X-ray crystal structure of the streptococcal specific phage lysin PlyC. McGowan S., Buckle AM., Mitchell MS., Hoopes JT., Gallagher DT., Heselpoth RD., Shen Y., Reboul CF., Law RH., Fischetti VA., Whisstock JC., Nelson DC. Only protein-protein interactions imex curation nelson-2006-4 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Nelson D., Schuch R., Chahales P., Zhu S., Fischetti VA. DIP original experiment: DIP-263345X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx PlyC: a multimeric bacteriophage lysin. Nelson D., Schuch R., Chahales P., Zhu S., Fischetti VA. Only protein-protein interactions imex curation nelson-2006-5 ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Nelson D., Schuch R., Chahales P., Zhu S., Fischetti VA. DIP original experiment: DIP-263346X Proceedings of the National Academy of Sciences of the United States of America 2006 IMEx PlyC: a multimeric bacteriophage lysin. Nelson D., Schuch R., Chahales P., Zhu S., Fischetti VA. Only protein-protein interactions imex curation aksyuk-2012-1 ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Aksyuk AA., Bowman VD., Kaufmann B., Fields C., Klose T., Holdaway HA., Fischetti VA., Rossmann MG. DIP original experiment: DIP-251763X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structural investigations of a Podoviridae streptococcus phage C1, implications for the mechanism of viral entry. Aksyuk AA., Bowman VD., Kaufmann B., Fields C., Klose T., Holdaway HA., Fischetti VA., Rossmann MG. Only protein-protein interactions imex curation aksyuk-2012-2 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Aksyuk AA., Bowman VD., Kaufmann B., Fields C., Klose T., Holdaway HA., Fischetti VA., Rossmann MG. DIP original experiment: DIP-251764X Proceedings of the National Academy of Sciences of the United States of America 2012 IMEx Structural investigations of a Podoviridae streptococcus phage C1, implications for the mechanism of viral entry. Aksyuk AA., Bowman VD., Kaufmann B., Fields C., Klose T., Holdaway HA., Fischetti VA., Rossmann MG. Only protein-protein interactions imex curation q7y3f1_9caud orf11 protein protein streptococcus phage c1 Streptococcus phage C1 MSKKYTQQQYEKYLAQPANNTFGLSPQQVADWFMGQAGARPVINSYGVNASNLVSTYIPKMQEYGVSYTLFLMYTVFEGGGAGNWINHYMYDTGSNGLECLEHDLQYIHGVWETYFPPALSAPECYPATEDNAGALDRFYQSLPGRTWGDVMIPSTMAGNAWVWAYNYCVNNQGAAPLVYFGNPYDSQIDSLLAMGADPFTGGSITGDGKNPSVGTGNATVSASSEANREKLKKALTDLFNNNLEHLSGEFYGNQVLNAMKYGTILKCDLTDDGLNAILQLIADVNLQTNPNPDKPTVQSPGQNDLGSGSDRVAANLANAQAQVGKYIGDGQCYAWVGWWSARVCGYSISYSTGDPMLPLIGDGMNAHSIHLGWDWSIANTGIVNYPVGTVGRKEDLRVGAIWCATAFSGAPFYTGQYGHTGIIESWSDTTVTVLEQNILGSPVIRSTYDLNTFLSTLTGLITFK q7y3f3_9caud orf9 protein protein streptococcus phage c1 Streptococcus phage C1 MSKINVNVENVSGVQGFLFHTDGKESYGYRAFINGVEIGIKDIETVQGFQQIIPSINISKSDVEAIRKAMKK q7y3f0_9caud orf12 protein protein streptococcus phage c1 Streptococcus phage C1 MTLSKIKLFYNTPFNNMQNTLHFNSNEERDAYFNSKFDVHEFTSTFNYRNMKGVLRVTIDLVSDRSCFEQLMGVNYCQVQYIQSNRVEYLFVTDIQQLNDKVCELSLVPDVVMTYTQGNVLNTLNNVNVIRQHYTQTEYEQNLEQIRSNNDVLATSTMRVHAIKSELFTQLEYILTIGANLRKSFGTAEKPKFPSSSGSTHDGIYNPYDMYWFNDYESLKEVMDYLTGYPWIQQSIKNVTIIPSGFIKQESLNDHEPVNGGDLSVRKLGKQGVSNQKDFNAISLDYQSLMFTLGLNPINDKHLLRPNIVTAELTDYAGNRLPIDLSLIETNLEFDSFVTMGAKNEIKVYVKNYNARGNNVGQYIDNALTINNFDTIGFSVDSGELGKANSAYSRELSNSRQMSSRINTVLDNDASVKDRLFNAISLSGGLSIKSALSGFNNEYEHYRDQKAQFKQMDALPNAITEGHVGYAPLFKQDKFGVHLRLGRISQDELNNVKKYYNMFGYECNDYSTKLSDITSMSICNWVQFKGIWTLPNVDTGHMNMLRALFEAGVRLWHKESDMINNTVVNNVIIK orf9-1 3242750 N/A 3242754 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false orf9-2 3242751 N/A 3242754 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false orf11-orf9-3 3242752 N/A 3242755 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3242754 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false orf11-orf9-4 3242753 N/A 3242755 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3242754 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false orf11-orf9-1 3145579 N/A 3242754 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3242755 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false orf11-orf9-2 3145580 N/A 3242754 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3242755 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false orf12-1 3243335 N/A 3243337 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false orf12-2 3243336 N/A 3243337 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false