mpidb The Microbial Protein Interaction Database zhou-2011b-1 Canonical SecA associates with an accessory secretory protein complex involved in biogenesis of a streptococcal serine-rich repeat glycoprotein. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zhou M., Zhang H., Zhu F., Wu H. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation q3s2y3_strag Protein translocase subunit SecA secA2 secA protein protein streptococcus agalac Streptococcus agalactiae MKKVVVKPKISILNKLRLQRIQKIVNEINNKKVYYAQLSDKELSHQTLILKNRLSSGESLDDILVDAFAVIREANKRILGLFPYDAQVMGAIALHQGTIAEMKTGEGKTLTATMPLYLNALTSKGAILVTTNDYLAKRDALEMGKVYQFLGMTVGINVFDKKEEADATIKREVYESDITYTTAGALGFDYLVHNLASNKLEQFLRPFHFVIVDEADSVLLDIAQTPLIIAGDPRVQSNLYGITNNFVLTLKENDEYIHKAKDKIVYLTEKGVSYAKQYFNISELYNDEYWELNRHINLALRAHCLYKRDYDYVVKNNEVKLLDNATGRVMEGTKLQSGIHQAIEAKEDVALTNESRAIASITYQSLFNMFPRLSGMTGTGKSSEDELIKTYHLPVIVIPTNFPIKRVDLADKIYVSLPEKLQATIDDVKQRHSKGQPVLLISGTVEIANIYSKLLLREGIAHNTLTADNVVKEAQIIKEAGQKGSVTCATVLAGRGTDIKLGEGVRELGGLAVIGTERMPNLRMDWQLRGRSGRQGDPGISQFYVSLEDELIVSHSPEWVIKYLKKYSRKETSNYYMVPRKKRFFYQIVKNAQLRSEDKGVSSREQTIKFGESLRIQRENIYQLRNELIADSSIVVDGVIKIIQDNFNDIANDKDLTEHSLRRYILENLTYKFKYFPDEFDVHNSDDVFKLLIDIFDREFTAKKTKLQSDNEFDNFVRISILKAIDKSWIEEVDSLQQLKGVVTNRGIGQRDIIQEYYKESLNSYYKMGKEIRYSIVKNIMLSTISKASDGSYSIYYV q3s2y4_strag asp3 protein protein streptococcus agalac Streptococcus agalactiae MILGECLVVKKRIQKVLWTDSSNVYLYGSTIKYLEHNRVFFENLRFSTGKTIKKWLSKTNFQANRTLPELTLLKPNHTYELVSKLTTVPEGCVIIQINFYNRQKEKIGFSIIRDHSSDFIVPDDTYFYDISLIGAGCISVEFCYLELFEVIETQEEKDGIELNSYVESSLPSELELIRTLIAFSKDKK a1c3l5_strpa gap1 protein protein streptococcus parasa Streptococcus parasanguis MFYFVPSWYNGQRQWYYDTPWWFRVKNRMTFDDSVNQVKMFLQGQEEIGLMILNYQPQLRYFLHKQNIFGIYYWSFFDDIQNITRSYTKIIHLKDLNWPEGCEFLYSPFAVVVRLKGEIFAIVNYAEDGNLHSVSFQKNGKVTKDYIFDDRGFLSSILYYDIDERPLYQDYLNINGVWQVREFLKKENDPTPILMINDFSDQTFSKKYYNGWEELIKERLAIFQNNHVENEDVFVLASDTQHNQLVSSIFKEHRKIYSFFGNRFNLENLGQDRISINDATFLVVDTEKNEELLRKTCENLVFKSIPIVRLSPFDSRLRLGHSQTVKEQIIYFHIDNIELDELYSVIAIILELMTLHLDIELRIVTFRQDFQLDLLKTWIIDFIKTNHFEDLLFKQISEGENEIEDEGEIELSRIAMECFTNENQIIKCLDTARLVIDLGIEPDLYTQIASISAGIPQINRVSSDYVIHQKNGLVISDISKLSSAIEFYFDGLFNWNEALIYAVRKMSDYTSGKILKQWKGMLKKK a1c3l7_strpa protein protein streptococcus parasa Streptococcus parasanguis MTKQLISEIYWNEIRKGENYLYGSQIKFQEDLVNFYNPQLASGKPIVTFKSRTNYQGDRHSPDLPILIQGNRYLLEYQIDAVPANSFFLQLDFFNRQAEQIESIVLRNSGESFIFPKDTFTYTLTLMSAGCQSVTYQKFMIYDINDEEKKNHIVENRYLRELLPKDLDLVKNLIEYI q7wwk0_strpa Protein translocase subunit SecA secA protein protein streptococcus parasa Streptococcus parasanguis MANLLKTIIENDRGEIKRLEKMADKVFSYEEQMAALTDDELKAKTVEFKQRYQDGESLDDLLYEAFAVVREGAKRVLGLFPYKVQVMGGIVLHHGDVPEMRTGEGKTLTATMPVYLNALSGKGVHVVTVNEYLTERDATEMGELYSWLGLSVGINLAAKSPAEKKEAYLCDITYSTNSEIGFDYLRDNMVVRAENMVQRPLNYALVDEVDSILIDEARTPLIVSGQTASDTSQLYHMADAYVKTLTEDDYIIDVPSKTIGLSDSGIDKAESYFNLENLYDIENVALTHFIDNALRANYIMILDIDYVVSEDQEILIVDQFTGRTMEGRRYSDGLHQAIEAKEGVPVQEETKTSASITYQNLFRMYKKLSGMTGTGKTEEEEFREIYNIRVIPIPTNRPIARIDHPDLLYPSLKSKFKAVVEDVKSRHEKGQPVLVGTVAVETSDYLSQLLVQAGVPHEVLNAKNHYKEAQIIMNAGQRGAVTIATNMAGRGTDIKLGEGVRELGGLCVIGTERHESRRIDNQLRGRSGRQGDPGESQFYLSLEDELMRRFGSERIKAVLDRFKLSEEESVIRSNMFTRQVEGAQKRVEGNNYDTRKQVLQYDDVMREQREIIYAERYDVITANRDLAPEIKAMIKRTIKRIVEGASHSSKEERIEAILNFAKYNLVPEDTISESDIEGKSDKEVIDYLYARAEEIYASQVAKLRDEESVQEFQKVLILRVVDSKWTDHIDALDQLRNAVGLRGYAQNNPVVEYQSESFRMFNDMIGSIEFDVTRLMMKAQIHEQERPRTEHSISTTATRNIAAQQDIPSGIDLSQVKRNDLCPCGSGKKFKNCHGRKF q7wuf6_strpa Protein translocase subunit SecA secA2 secA protein protein streptococcus parasa Streptococcus parasanguis MEKIKQKRSFINTMKLRRLRKKLVKINALKETMSLLSDEELKQKTVEFRNRLHEGETLEDILIEAFAAIREADRRILGMFPFDVQVLGALALHEGTIVEMKTGEGKTLTATLPLYLNALEGKGTILVTTNDYLARRDAIDMGEVYRFMGLTVGVGVFDDDEEVDSNRKKKIYSSDILYTTSTALGFDYLIDNLAGNVEDKFLRSFNYVIVDEADAVLLDSAQTPLIIAGSPRVQSNLYDTADQFIRTLKKDQEFKFLKDEKFIFLTDEGIRYAEKYFNIPNLYSEEYFELNRHINLALRAHYLFKKDMDYVVTDDAVELLDNRTGRILEGTRLQSGIHQAIETKEKVKKSKDSRAIASVTYQSLFNMFPKLSGMTGTGKIAENELISTYGVSVVVLPTNTPIQRLDYSDKIYTTLPEKLLATLEFVKELHEKQQPILLISGTVDIAEIYSRMLLQEGIPHNVLTAKNIAKEALIIAEAGQKGAVTVATSLAGRGTDIKLGKGVAELGGLAVIGTERMPNSRIDWQLRGRAGRQGDPGLSQFFVSLEDDLIMNHANRRLKKYFEKQNSIDRKNYGKPLFSKRFSRIVTHAQQKSEDKSESARQNTIKFDESLKSQRKKIYHLRDQLIFGEVKLRDRLDKLISEYIEMYMENNRKFGLNQNDFKRFILENFTYQLRSLPKSLDLSNSRQVKDYLFYLYQLEMERKSKQLKTDSKVEEFIRLSILRAIDECWIQQVDHLQQLKTFVSMRQIAQRDSFNEYLRESLESYEEMSREVKHAIVKNVMLSTIEGKVDDGLSIYFV q3s2y6_strag asp1 protein protein streptococcus agalac Streptococcus agalactiae MFYFIPSWYNSDQKWHNEAPIWYRVLENMTFDDTVSQVRMFQNADEEVRLLLFSYNPQLRYMLHEESMLAVSYWSFFDDIQNIQQKEIKLINFKELNWPKGTYFVYTPFLVLAKHGGEIIARIQFAENGNLLLIELLIDGVLDKIMIFDDRGFVSSIKYFKQNRLIYQDYLNQNGVWQIREYASKFPRIVVNPMSDKVFNFTEYDDWDTLIRERILVLKKLEVTPDDYIIVAVNDIHNNLVRKSFPDQKKIFSFFGERYSFDNRLDFNELLDEGELFIAESEKIERLLITSLQEKNYSSNYVENHISRIPPFDTRLRLGQSQNIEELIAYLLVDDLSQTYLSEVLDQLLAKMEVNPSLELKIVSYKNDYDMTSLKEQVKDKILSSKNPDYFFTSLSLEDENHFKEEQKTKIRGISFDIYTNENQIIDALDTARLVIDLRDDPDLYTQIAALSSGIPQINKVHTNYVEHQKNGWIISDSTELNNAIDYYFDGLMNWNKSLVYSVKKMGDYTSGKILQRWRKLLEKE a1c3l7-seca-2 1339173 not-defined-5674728 1339176 unspecified role unspecified role bait bait a1c3l7-- A1C3L7-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli n/a 1339177 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false figure 7C a1c3l7-seca-3 1339173 n/a 1339178 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1625946374 1339176 unspecified role unspecified role bait bait a1c3l7-- A1C3L7-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false figure 7A seca-gap3 1339173 n/a 1339177 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1344476826 1339176 unspecified role unspecified role prey prey a1c3l7-- A1C3L7-- myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false figure 7B seca2-seca 1339173 not-defined-80488157 1339177 unspecified role unspecified role bait bait q7wwk0-- Q7WWK0-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1793029382 1339178 unspecified role unspecified role prey prey q7wuf6-- Q7WUF6-- myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 7A asp1-seca2 1339173 not-defined-1742126980 1339179 unspecified role unspecified role bait bait q3s2y6-- Q3S2Y6-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1468043820 1339180 unspecified role unspecified role prey prey region Q3S2Y3-- myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 5C asp1-asp3 1339173 not-defined-1217462669 1339181 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1572495603 1339179 unspecified role unspecified role bait bait q3s2y6-- Q3S2Y6-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 5B asp3-asp1 1339173 not-defined-1506833149 1339179 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-623072176 1339181 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 5A seca2-asp3 1339173 not-defined-1158056691 1339181 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-453850712 1339180 unspecified role unspecified role bait bait q3s2y3-- Q3S2Y3-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 5B seca2-asp1 1339173 not-defined-1524874705 1339179 unspecified role unspecified role prey prey q3s2y6-- Q3S2Y6-- myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-2083938638 1339180 unspecified role unspecified role bait bait q3s2y3-- Q3S2Y3-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 5A a1c3l7-seca-1 1339173 n/a 1339178 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-310941805 1339176 unspecified role unspecified role bait bait a1c3l7-- A1C3L7-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false figure 2B gap1-seca2 1339173 n/a 1339178 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-1245987924 1339182 unspecified role unspecified role bait bait a1c3l5-- A1C3L5-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false figure 2B seca2-gap1 1339173 n/a 1339178 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-390213560 1339182 unspecified role unspecified role prey prey a1c3l5-- A1C3L5-- myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 2A DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ schormann-2015-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schormann N., Ayres CA., Fry A., Green TJ., Banerjee S., Ulett GC., Chattopadhyay D. dchattop@uabmc.edu PloS one 2015 Only protein-protein interactions imex curation imex curation schormann-2015-2 ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schormann N., Ayres CA., Fry A., Green TJ., Banerjee S., Ulett GC., Chattopadhyay D. dchattop@uabmc.edu PloS one 2015 Only protein-protein interactions imex curation imex curation q9alw2_strag Glyceraldehyde-3-phosphate dehydrogenase gap gapA AX245_09885 C4618_13560 DK41_09330 F5043_02580 GL192_06995 NCTC6175_00390 NCTC8183_01962 RDF_1710 TH70_1537 protein protein streptococcus agalac Streptococcus agalactiae MVVKVGINGFGRIGRLAFRRIQNVEGVEVTRINDLTDPNMLAHLLKYDTTQGRFDGTVEVKEGGFEVNGQFVKVSAEREPANIDWATDGVEIVLEATGFFASKEKAEQHIHENGAKKVVITAPGGNDVKTVVFNTNHDILDGTETVISGASCTTNCLAPMAKALQDNFGVKQGLMTTIHAYTGDQMILDGPHRGGDLRRARAGAANIVPNSTGAAKAIGLVIPELNGKLDGAAQRVPVPTGSVTELVATLEKDVTVEEVNAAMKAAANDSYGYTEDPIVSSDIVGISYGSLFDATQTKVQTVDGNQLVKVVSWYDNEMSYTSQLVRTLEYFAKIAK gap-2 4110102 N/A 4110104 unspecified role unspecified role neutral component neutral component purified purified His tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 direct interaction direct interaction false false false Table 1 gap-3 4110102 N/A 4110104 unspecified role unspecified role neutral component neutral component purified purified His tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q9ALW2:p.Cys152Ser p.C152S mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 direct interaction direct interaction false false false Table 1 gap-5 4110103 N/A 4110104 unspecified role unspecified role neutral component neutral component purified purified His tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 direct interaction direct interaction false false false Table 1 MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint boer-2009-1 Plasmid replication initiator RepB forms a hexamer reminiscent of ring helicases and has mobile nuclease domains. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Boer DR., Ruíz-Masó JA., López-Blanco JR., Blanco AG., Vives-Llàcer M., Chacón P., Usón I., Gomis-Rüth FX., Espinosa M., Llorca O., del Solar G., Coll M. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation boer-2009-2 Plasmid replication initiator RepB forms a hexamer reminiscent of ring helicases and has mobile nuclease domains. in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Boer DR., Ruíz-Masó JA., López-Blanco JR., Blanco AG., Vives-Llàcer M., Chacón P., Usón I., Gomis-Rüth FX., Espinosa M., Llorca O., del Solar G., Coll M. EMBO J. (0261-4189) 2009 Only protein-protein interactions imex curation repb_strag Replication protein RepB repB protein protein streptococcus agalac Streptococcus agalactiae MAKEKARYFTFLLYPESIPSDWELKLETLGVPMAISPLHDKDKSSIKGQKYKKAHYHVLYIAKNPVTADSVRKKIKLLLGEKSLAMVQVVLNVENMYLYLTHESKDAIAKKKHVYDKADIKLINNFDIDRYVTLDVEEKTELFNVVVSLIRAYTLQNIFDLYDFIDENGETYGLTINLVNEVIAGKTGFMKLLFDGAYQRSKRGTKNEER mint repb-1 858112 repb_strag repB 858114 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 6.0 direct interaction direct interaction false false false F2 F3 mint repb-1 858113 repb_strag repB 858114 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 6.0 direct interaction direct interaction false false false F6 mint