DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ born-2017-1 ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Born DA., Ulrich EC., Ju KS., Peck SC., van der Donk WA., Drennan CL. cdrennan@mit.edu Science (New York, N.Y.) 2017 imex curation Only protein-protein interactions imex curation okamura-2010-1 ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Okamura E., Tomita T., Sawa R., Nishiyama M., Kuzuyama T. DIP original experiment: DIP-219854X Proceedings of the National Academy of Sciences of the United States of America 2010 IMEx Unprecedented acetoacetyl-coenzyme A synthesizing enzyme of the thiolase superfamily involved in the mevalonate pathway. Okamura E., Tomita T., Sawa R., Nishiyama M., Kuzuyama T. Only protein-protein interactions imex curation mpns_nitms Methylphosphonate synthase mpnS Nmar_0155 protein protein Nitrosopumilus maritimus (strain SCM1) Nitrosopumilus maritimus (strain SCM1) MEKKIDFKPDSYLIRSGNNFLGILNDIKRRPEDAANELGVSIEEINSIISGKQKISPSLIEKAVNIWPVNERDFYIVSDDCSSGILIMTSQDSIKSSRIMERAGKPYYEYRDTAMSKTAPFRPEWILELCKVENNDPENPKAQWNNGHFMHQFTYFIGEVNFYYKDPEGKKHVAIMNTGDSMYITPFTPHTFTTRDGASQNGLILALTYGSKLTGDIQQELSSLSLDCGSQYALDFTNHENASLSLLEYYFELSNLTKEKFAKRTNFSMETLADFFTKKKLPTFDELKIIAKALNVNSRDLMPNDLTESKVIVKTHDQCDHWKYPESGNYEFYELASTTALPHSKAFEIDVSSSEDLNLDLKVGLHQYVYNIGDSALTINWNYENKTYQKSLNPGDSAYIKPFVPHNFRGNGKILILRIGGKISGDSQRELSFVGRENTQRAISETMQWFDPKGSNS sahepd SaHEPD protein protein strc1 Streptomyces sp. (strain CL190) npht7_strc1 Acetoacetyl CoA synthase NphT7 nphT7 fhsA protein protein strc1 Streptomyces sp. (strain CL190) MTDVRFRIIGTGAYVPERIVSNDEVGAPAGVDDDWITRKTGIRQRRWAADDQATSDLATAAGRAALKAAGITPEQLTVIAVATSTPDRPQPPTAAYVQHHLGATGTAAFDVNAVCSGTVFALSSVAGTLVYRGGYALVIGADLYSRILNPADRKTVVLFGDGAGAMVLGPTSTGTGPIVRRVALHTFGGLTDLIRVPAGGSRQPLDTDGLDAGLQYFAMDGREVRRFVTEHLPQLIKGFLHEAGVDAADISHFVPHQANGVMLDEVFGELHLPRATMHRTVETYGNTGAASIPITMDAAVRAGSFRPGELVLLAGFGGGMAASFALIEW mpns-1 3439408 N/A 3439409 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Table S1 sahepd-1 3439408 N/A 3439410 unspecified role unspecified role neutral component neutral component purified purified His tag His tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) It should be - Streptomyces albus subsp. albus strain NRRL B-16041 Stoichiometry: 2.0 direct interaction direct interaction false false false npht7-1 3210046 N/A 3210047 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false